DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ulk1 and Aduk

DIOPT Version :9

Sequence 1:XP_011247721.1 Gene:Ulk1 / 22241 MGIID:1270126 Length:1079 Species:Mus musculus
Sequence 2:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster


Alignment Length:292 Identity:114/292 - (39%)
Similarity:168/292 - (57%) Gaps:32/292 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 FEFSRKDLIGHGAFAVVFKGRHREVGEAPAEASQSRTPSPRDTLPPKHDLEVAVKCINKKNLAK- 77
            ||...|  :|.|::|.|:|.||:          :.||         .|    |:|.:....|:: 
  Fly     9 FEILEK--LGAGSYATVYKARHK----------KQRT---------YH----AIKYVEMSTLSQT 48

Mouse    78 SQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQ 142
            |:..|..||::|:||||:.||.|.||.....::|:|:||||.|:|:.::.|.:.|.|.|.|.||:
  Fly    49 SRENLITEIRLLRELKHKYIVTLQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLR 113

Mouse   143 QIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAATLCGSP 207
            |:|.|::.:.:..:.|.||||||:||:    |.||  |:.:|:||||||::|:...:...|.|||
  Fly   114 QLAAAVQYMRANDVSHFDLKPQNLLLT----RGAN--NVSLKVADFGFAQHLKLGEINQQLKGSP 172

Mouse   208 MYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPAIPRETSAP 272
            :|||||::....||.||||||||.|:|:||.||||:.:.:.::|.|...|.:.:........|..
  Fly   173 LYMAPEIVRKHQYDAKADLWSIGVILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARISNE 237

Mouse   273 LRQLLLALLQRNHKDRMDFDEFFHHPFLDAST 304
            ...||..||......|:.|.:||.|||||..|
  Fly   238 CHDLLRRLLAHEPTARISFADFFAHPFLDLKT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ulk1XP_011247721.1 PKc_like 13..301 CDD:389743 111/287 (39%)
DUF3543 866..1073 CDD:371876
AdukNP_731331.1 S_TKc 9..265 CDD:214567 110/286 (38%)
PKc_like 13..264 CDD:304357 107/281 (38%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5656
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.