DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp3 and Bmcp

DIOPT Version :9

Sequence 1:NP_033490.1 Gene:Ucp3 / 22229 MGIID:1099787 Length:308 Species:Mus musculus
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:301 Identity:104/301 - (34%)
Similarity:165/301 - (54%) Gaps:30/301 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    17 FLGAGTAACFADLLTFPLDTAKVRLQIQGE--NPGAQSVQYRGVLGTILTMVRTEGPRSPYSGLV 79
            |:..|.|:..|:..|||:||.|.||||||:  :.....::|||:....:.:.|.||.|:.|||:.
  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74

Mouse    80 AGLHRQMSFASIRIGLYDSVKQFYTPKG----ADHSS-VAIRILAGCTTGAMAVTCAQPTDVVKV 139
            ..:.||.::.:|:.|.|.::|:....:|    .|.|. |...||.....||::...|.||||:||
  Fly    75 PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKV 139

Mouse   140 RFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIKEKLL 204
            |.|      ..|:.:::|.:..:..|.:.|||||||:|..|...|..::...|:..||..|.:|:
  Fly   140 RMQ------VHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLM 198

Mouse   205 ESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMN---------------APLGRYRSPLH 254
            .:  |.|:...||:|:|.|...:.:.::|:||::||.||               |....|...|.
  Fly   199 NA--FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLD 261

Mouse   255 CMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKR 295
            |.::.:..||..|.||||:|:::|:|.||::.|:||||||:
  Fly   262 CAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp3NP_033490.1 Mito_carr 10..107 CDD:278578 32/91 (35%)
Solcar 1 11..102 32/86 (37%)
PTZ00169 13..298 CDD:240302 104/301 (35%)
Mito_carr 109..206 CDD:278578 34/97 (35%)
Solcar 2 111..202 32/91 (35%)
Mito_carr 209..299 CDD:278578 37/102 (36%)
Solcar 3 211..296 36/100 (36%)
Purine nucleotide binding. /evidence=ECO:0000250 275..297 11/21 (52%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/86 (37%)
Mito_carr <132..199 CDD:278578 26/72 (36%)
Mito_carr 204..303 CDD:278578 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.