DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uchl1 and Uch

DIOPT Version :9

Sequence 1:NP_035800.2 Gene:Uchl1 / 22223 MGIID:103149 Length:223 Species:Mus musculus
Sequence 2:NP_001188681.1 Gene:Uch / 33397 FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster


Alignment Length:222 Identity:102/222 - (45%)
Similarity:150/222 - (67%) Gaps:6/222 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 PMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHENFRKKQIEE 69
            |:|.|||:|.|.:.||||:..|...||:|||::||..:|.|..|.:||||.:..:|..|.::.:.
  Fly     6 PLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEHDR 70

Mouse    70 LKG-QEVSPK-VYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPEDRAKC 132
            :|. :|..|: :::|:|...|:|||:.|||:||||:: ::.:.| |||.||.:|..||||:|.:.
  Fly    71 IKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKE-VDIDRG-VLKDFLEKTASLSPEERGRA 133

Mouse   133 FEKNEAIQAAHDSVAQEGQCRV--DDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDSLLQ 195
            .||:|...|.|:::|||||...  .:||..|||...|.:|.|||||||..||:.||.:||::.::
  Fly   134 LEKDEKFTADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETFVK 198

Mouse   196 DAAKVCREFTEREQGEVRFSAVALCKA 222
            ||||||:||..|:..||||:.:||..|
  Fly   199 DAAKVCKEFMARDPNEVRFTVLALTAA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uchl1NP_035800.2 Peptidase_C12_UCH_L1_L3 5..219 CDD:187737 99/217 (46%)
Interaction with ubiquitin. /evidence=ECO:0000250|UniProtKB:P09936 5..10 2/4 (50%)
Interaction with ubiquitin. /evidence=ECO:0000250|UniProtKB:P09936 211..216 4/4 (100%)
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 99/217 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831400
Domainoid 1 1.000 208 1.000 Domainoid score I2849
eggNOG 1 0.900 - - E1_KOG1415
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3443
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53971
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001664
OrthoInspector 1 1.000 - - otm43659
orthoMCL 1 0.900 - - OOG6_101218
Panther 1 1.100 - - O PTHR10589
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1588
SonicParanoid 1 1.000 - - X1061
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.