DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube2b and Ubc6

DIOPT Version :9

Sequence 1:NP_001349614.1 Gene:Ube2b / 22210 MGIID:102944 Length:152 Species:Mus musculus
Sequence 2:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster


Alignment Length:151 Identity:130/151 - (86%)
Similarity:140/151 - (92%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPN 65
            |||||||||||||||||||||.||||||::||||.||||||||..||||||||||.|||:|||||
  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65

Mouse    66 KPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLY 130
            |||||||:||:|||||||||.|||||||||||||||||:|||||||||.:|||||||||.|||||
  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130

Mouse   131 QENKREYEKRVSAIVEQSWND 151
            :||:|||||||.|.||||:.|
  Fly   131 KENRREYEKRVKACVEQSFID 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube2bNP_001349614.1 UQ_con 8..145 CDD:395127 118/136 (87%)
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 118/136 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835700
Domainoid 1 1.000 259 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E2759_KOG0419
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 281 1.000 Inparanoid score I2874
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54755
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001694
OrthoInspector 1 1.000 - - otm43068
orthoMCL 1 0.900 - - OOG6_101178
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1583
SonicParanoid 1 1.000 - - X1087
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.