DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube2e1 and CG2574

DIOPT Version :9

Sequence 1:NP_033481.1 Gene:Ube2e1 / 22194 MGIID:107411 Length:193 Species:Mus musculus
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:206 Identity:93/206 - (45%)
Similarity:121/206 - (58%) Gaps:27/206 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 SSSSSNQQTEKEGSTPKKKESKV---------------------SMSKNSKLLSTSAK------R 51
            ||...|.|||.|.....:.|.:|                     |.|.::...||.|.      |
  Fly     2 SSDQVNSQTEMETEARARAEVEVEVEPEVLSRASVASSVEETAPSTSHSASGKSTEAPLTGCVVR 66

Mouse    52 IQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFR 116
            |:.||.||..:|||||:|.....::..|.:.:.||.|||||||.|.|||.|...|||:.|::.|.
  Fly    67 IKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFT 131

Mouse   117 TRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHD 181
            |||||||::|:|.||||:|.:.|||.:.::||||||..|:::|||.||||..||.||.|||.|||
  Fly   132 TRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHD 196

Mouse   182 RMARQWTKRYA 192
            ::||.|||.:|
  Fly   197 KIARHWTKLFA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube2e1NP_033481.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 11/51 (22%)
UQ_con 51..188 CDD:395127 75/136 (55%)
CG2574NP_572796.1 COG5078 66..208 CDD:227410 79/142 (56%)
UQ_con 66..203 CDD:278603 75/136 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.