| Sequence 1: | NP_001994.2 | Gene: | FCN1 / 2219 | HGNCID: | 3623 | Length: | 326 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_609018.3 | Gene: | CG9500 / 33888 | FlyBaseID: | FBgn0031804 | Length: | 292 | Species: | Drosophila melanogaster |
| Alignment Length: | 199 | Identity: | 83/199 - (41%) |
|---|---|---|---|
| Similarity: | 115/199 - (57%) | Gaps: | 4/199 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Human 130 GWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIH 194
Human 195 ALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLV-LGAFVGGSAGNSLTGHNNNFFST 258
Human 259 KDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYA--NGINWSAAKGYKYSYKVSEM 321
Human 322 KVRP 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| FCN1 | NP_001994.2 | Collagen | 51..107 | CDD:189968 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 72..111 | ||||
| FReD | 115..325 | CDD:238040 | 81/197 (41%) | ||
| A domain, contributes to trimerization | 115..154 | 7/23 (30%) | |||
| B domain, contributes to trimerization | 155..243 | 35/88 (40%) | |||
| Carbohydrate-binding. /evidence=ECO:0000269|PubMed:17897951 | 282..284 | 0/1 (0%) | |||
| P domain. /evidence=ECO:0000303|PubMed:17148457 | 317..326 | 6/9 (67%) | |||
| CG9500 | NP_609018.3 | FReD | 76..287 | CDD:238040 | 83/199 (42%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 186 | 1.000 | Domainoid score | I3350 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 188 | 1.000 | Inparanoid score | I3915 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000029 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X25 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.860 | |||||