DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCN1 and CG31832

DIOPT Version :9

Sequence 1:NP_001994.2 Gene:FCN1 / 2219 HGNCID:3623 Length:326 Species:Homo sapiens
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:224 Identity:82/224 - (36%)
Similarity:114/224 - (50%) Gaps:17/224 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   104 DAGQS--QSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSV 166
            :.|||  .:|.:|..|            |.|.:.||:..|..| ....|....|.|.|||:||||
  Fly    16 EVGQSSPHTCPSGSPN------------GIHQLMLPEEEPFQV-TQCKTTARDWIVIQRRLDGSV 67

Human   167 DFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEK 231
            :|.:.|.:||.|||...|||::|...::.:|.:...||.:.|....|...:|.:..|:|..|.|.
  Fly    68 NFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETEL 132

Human   232 YKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGP 296
            |||.......|:||:||..|.|..|||.|:|||.||.|||.:..|.||:..|.:|:|||||....
  Fly   133 YKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREG 197

Human   297 HESYANGINWSAAKGYKYSYKVSEMKVRP 325
            .....|||:|...|....::  .::.:||
  Fly   198 ETGMLNGIHWGRWKFQSLTF--VQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCN1NP_001994.2 Collagen 51..107 CDD:189968 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..111 3/8 (38%)
FReD 115..325 CDD:238040 75/209 (36%)
A domain, contributes to trimerization 115..154 8/38 (21%)
B domain, contributes to trimerization 155..243 33/87 (38%)
Carbohydrate-binding. /evidence=ECO:0000269|PubMed:17897951 282..284 0/1 (0%)
P domain. /evidence=ECO:0000303|PubMed:17148457 317..326 2/9 (22%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 78/212 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.