DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zrsr1 and U2af38

DIOPT Version :9

Sequence 1:NP_035793.1 Gene:Zrsr1 / 22183 MGIID:98885 Length:428 Species:Mus musculus
Sequence 2:NP_001259814.1 Gene:U2af38 / 33201 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster


Alignment Length:269 Identity:85/269 - (31%)
Similarity:134/269 - (49%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse   157 EKYRPSCPFYNKTGACRFGNRCSRKHDFPTSSPTLLVKSMFTTFGMEQCRRDDYDSDANLEYSEE 221
            ||.:.:|.||.|.||||.|:||||.|:.||.|.|:|:::::..........|.....||:  |:|
  Fly    12 EKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAKSADGSHLVANV--SDE 74

Mouse   222 ETYQQFLDFYHDVLPEFKN-VGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAG 285
            |..:.:.:|:.||..|.:: .|::.:..|..||..||.||||:::::|.:.:.|.:..|.||:.|
  Fly    75 EMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAEKAANDLNNRWFGG 139

Mouse   286 RQLQCEFCPVTRWKVAICGLFEMQKCPKGKHCNFLHVFRNPNNEFREANRDIYMSPPAWTGSSGK 350
            |.:..|..|||.::.|.|..:||.:|.:...|||:|:  .|.:  ||..|.:|            
  Fly   140 RPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMHL--KPIS--RELRRYLY------------ 188

Mouse   351 NSDRRERKDHHEEYYSKSRSYHSGSYHSSK-RNRESERKSPHRWKKSHKQTTKSHERHSSR---R 411
              .||.|        ::|||...|....|: |:|...|:...|..........::||.:.|   |
  Fly   189 --SRRRR--------ARSRSRSPGRRRGSRSRSRSPGRRGGGRGDGVGGGNYLNNERDNMRGNDR 243

Mouse   412 GREEDSSPG 420
            |.:.|...|
  Fly   244 GNDRDRRKG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zrsr1NP_035793.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
zf-CCCH 158..183 CDD:279036 14/24 (58%)
RRM_U2AFBPL 190..294 CDD:240984 30/104 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..428 19/86 (22%)
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 15/25 (60%)
RRM_U2AF35 43..148 CDD:240982 31/106 (29%)
zf-CCCH 151..177 CDD:279036 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340384at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.