DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRPS1L1 and Pdha

DIOPT Version :10

Sequence 1:NP_787082.1 Gene:PRPS1L1 / 221823 HGNCID:9463 Length:318 Species:Homo sapiens
Sequence 2:NP_726945.1 Gene:Pdha / 31406 FlyBaseID:FBgn0028325 Length:443 Species:Drosophila melanogaster


Alignment Length:65 Identity:13/65 - (20%)
Similarity:26/65 - (40%) Gaps:19/65 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   245 YAILTHGIFSGPA---ISRINTACFEAVVVTN----------------TIPQDEKMKHCSKIRVI 290
            |:....|:|...|   :|:.|....||.|..|                .:.:|:.:|:.::::.|
  Fly    55 YSSSFFGLFQNAAQAGVSKTNNYATEATVQVNRPFKLHRLDEGPATEVKLTKDQALKYYTQMQTI 119

Human   291  290
              Fly   120  119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRPS1L1NP_787082.1 PrsA 1..314 CDD:440230 13/65 (20%)
Binding of phosphoribosylpyrophosphate. /evidence=ECO:0000255 212..227
PdhaNP_726945.1 TPP_enzymes 78..426 CDD:470272 7/42 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.