DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM24 and HRP1

DIOPT Version :9

Sequence 1:NP_001137414.1 Gene:RBM24 / 221662 HGNCID:21539 Length:236 Species:Homo sapiens
Sequence 2:NP_014518.1 Gene:HRP1 / 853997 SGDID:S000005483 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:46/184 - (25%)
Similarity:72/184 - (39%) Gaps:58/184 - (31%)


- Green bases have known domain annotations that are detailed below.


Human     5 QKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERAC 69
            ::|.| .||||||:..........::|..:|.|.:|.::.|:.||:|||:||||.....|.:|.|
Yeast   238 EQDKT-GKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVC 301

Human    70 KDPNPIIDGRKANVNLAYLGAKPRIMQP-----------------GFAFGVQ------------- 104
            :  |..||.:...:.:.  .|:||.||.                 |..||.|             
Yeast   302 Q--NKFIDFKDRKIEIK--RAEPRHMQQKSSNNGGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMG 362

Human   105 ----QLHPAL--------------IQRPFGIPAHYVYPQ-----AFVQPGVVIP 135
                .::|..              :|:..|:....:|.|     |.:.||..:|
Yeast   363 GYNPMMNPQAMTDYYQKMQEYYQQMQKQTGMDYTQMYQQQMQQMAMMMPGFAMP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM24NP_001137414.1 RRM_RBM24_RBM38_like 11..86 CDD:409818 26/74 (35%)
Necessary for interaction with EIF4E. /evidence=ECO:0000269|PubMed:29358667 175..199
HRP1NP_014518.1 PABP-1234 <144..463 CDD:130689 46/184 (25%)
RRM1_Hrp1p 161..236 CDD:409991
RRM2_Hrp1p 244..321 CDD:409767 27/80 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.