Sequence 1: | NP_001137414.1 | Gene: | RBM24 / 221662 | HGNCID: | 21539 | Length: | 236 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001162897.1 | Gene: | Hrb27C / 33968 | FlyBaseID: | FBgn0004838 | Length: | 421 | Species: | Drosophila melanogaster |
Alignment Length: | 255 | Identity: | 55/255 - (21%) |
---|---|---|---|
Similarity: | 100/255 - (39%) | Gaps: | 51/255 - (20%) |
- Green bases have known domain annotations that are detailed below.
Human 12 KIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPII 76
Human 77 DGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFG-------------IPAHYVYPQAFV 128
Human 129 QPG------VVIPHVQPTAAAASTTPYIDYTG------AAY-------------AQYS--AAAAA 166
Human 167 AAAAAAYDQYPYAASPAAAGYVTAGGYGYAVQQPITAAAPGTAAAAAAAAAAAAAFGQYQ 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RBM24 | NP_001137414.1 | RRM_RBM24_RBM38_like | 11..86 | CDD:409818 | 22/73 (30%) |
Necessary for interaction with EIF4E. /evidence=ECO:0000269|PubMed:29358667 | 175..199 | 5/23 (22%) | |||
Hrb27C | NP_001162897.1 | RRM1_DAZAP1 | 8..89 | CDD:241018 | |
RRM2_DAZAP1 | 94..173 | CDD:240773 | 23/84 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |