DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM24 and Hrb27C

DIOPT Version :9

Sequence 1:NP_001137414.1 Gene:RBM24 / 221662 HGNCID:21539 Length:236 Species:Homo sapiens
Sequence 2:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster


Alignment Length:255 Identity:55/255 - (21%)
Similarity:100/255 - (39%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    12 KIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPII 76
            |:|:||||.:.|:..||.:|..:|::.|.|::.|::..||||:||::..:.::.|....:....:
  Fly    97 KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINL 161

Human    77 DGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFG-------------IPAHYVYPQAFV 128
            :|::..:..|         :|....|.|..:.:.:...:|             .|.:.:..|...
  Fly   162 NGKQVEIKKA---------EPRDGSGGQNSNNSTVGGAYGKLGNECSHWGPHHAPINMMQGQNGQ 217

Human   129 QPG------VVIPHVQPTAAAASTTPYIDYTG------AAY-------------AQYS--AAAAA 166
            ..|      :..|::.|......|:|.....|      .:|             .|:|  |....
  Fly   218 MGGPPLNMPIGAPNMMPGYQGWGTSPQQQQYGYGNSGPGSYQGWGAPPGPQGPPPQWSNYAGPQQ 282

Human   167 AAAAAAYDQYPYAASPAAAGYVTAGGYGYAVQQPITAAAPGTAAAAAAAAAAAAAFGQYQ 226
            ......||.|...::.|.:| .:.||...:...|..:|.| |.|..|.|..|...:.:.|
  Fly   283 TQGYGGYDMYNSTSTGAPSG-PSGGGSWNSWNMPPNSAGP-TGAPGAGAGTATDMYSRAQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM24NP_001137414.1 RRM_RBM24_RBM38_like 11..86 CDD:409818 22/73 (30%)
Necessary for interaction with EIF4E. /evidence=ECO:0000269|PubMed:29358667 175..199 5/23 (22%)
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018
RRM2_DAZAP1 94..173 CDD:240773 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.