DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twist1 and twi

DIOPT Version :9

Sequence 1:NP_035788.1 Gene:Twist1 / 22160 MGIID:98872 Length:206 Species:Mus musculus
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:281 Identity:84/281 - (29%)
Similarity:116/281 - (41%) Gaps:80/281 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 MQDVSSSPVS------------------PADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGG 48
            :|...:||.|                  |..::.....::..:|||..........:::.|.:..
  Fly   211 VQSTCTSPQSHFDFPDEELPEHKAQVFLPLYNNQQQQSQQLQQQQPHQQSHAQMHFQNAYRQSFE 275

Mouse    49 SAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGGGGGGG-------AGGGGGGG--GGSSSGG--- 101
            ...|..:..|......:.......:....|:.....||       |..|..|.  .||.:||   
  Fly   276 GYEPANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAF 340

Mouse   102 -----------GSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKL 155
                       ...:..:|...|||||||||||||||||:||.:|::||||||||||||||||||
  Fly   341 RKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSDKLSKIQTLKL 405

Mouse   156 AARYIDFLYQVLQSDE------LDSKMASCSY-----------------------------VAHE 185
            |.||||||.::|.|.:      |:::.:..:|                             :..|
  Fly   406 ATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEADLKCLRKANGAPIIPPE 470

Mouse   186 RLSYAFSVWRMEGAWSMSASH 206
            :|||.|.||||||    .|.|
  Fly   471 KLSYLFGVWRMEG----DAQH 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Twist1NP_035788.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..109 21/147 (14%)
HLH 113..163 CDD:306515 43/49 (88%)
Sufficient for transactivation activity 165..195 10/64 (16%)
twiNP_001033967.1 HLH 363..413 CDD:278439 43/49 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839675
Domainoid 1 1.000 90 1.000 Domainoid score I7765
eggNOG 1 0.900 - - E1_KOG4447
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4941
Isobase 1 0.950 - 0 Normalized mean entropy S4574
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001055
OrthoInspector 1 1.000 - - otm43384
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 1 1.000 - - X1477
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.