DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR3B and bdl

DIOPT Version :9

Sequence 1:NP_000561.3 Gene:FCGR3B / 2215 HGNCID:3620 Length:233 Species:Homo sapiens
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:191 Identity:40/191 - (20%)
Similarity:68/191 - (35%) Gaps:39/191 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     8 TALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLIS---- 68
            ||..|.|..|        :::.:.|...::.|..:....|...: ||::...|:.:..|:.    
  Fly   141 TAYHLAVQGG--------SLIRIPPVNQTIREGQTAFFHCVMKH-PENSQASWYKDGVLLQEVQD 196

Human    69 -------SQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQ-------APRWVF- 118
                   ....|..||...::|.|||.|:..    :...:|:....:|.:|       ||..|| 
  Fly   197 LVRRFYMGPDGSLSIDPTMMSDLGEYECKVR----NSDGELQTAKAFLNIQYKAKVIYAPPEVFL 257

Human   119 KEEDPIHLRCHSWKNTALHKVTYLQNG-------KDRKYFHHNSDFHIPKATLKDSGSYFC 172
            ....|..|.||...|..|..:.:.::|       ....::..|......|.....:|||.|
  Fly   258 PYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR3BNP_000561.3 Ig1_FcgammaR_like 26..104 CDD:143229 16/88 (18%)
Ig2_FcgammaR_like 108..190 CDD:319307 19/80 (24%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 17/93 (18%)
Ig 157..242 CDD:299845 17/89 (19%)
Ig_2 252..337 CDD:290606 16/67 (24%)
IG_like 260..327 CDD:214653 13/59 (22%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.