DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KIF6 and Klp54D

DIOPT Version :9

Sequence 1:XP_005248961.1 Gene:KIF6 / 221458 HGNCID:21202 Length:842 Species:Homo sapiens
Sequence 2:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster


Alignment Length:531 Identity:151/531 - (28%)
Similarity:236/531 - (44%) Gaps:109/531 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     3 KQTIQIFARVKPPVRKHQQGIYSIDEDEK--------LIP-SLEIILP-RDLADGFVNNKRESYK 57
            :..|.:..||:|           :::.||        ..| :.::||. .|:.....:|:.....
  Fly   164 EDNINVVVRVRP-----------LNDKEKRDRHGSTLQFPGNGQVILEGNDVGQKRSHNRDSVRV 217

Human    58 FKFQRIFDQDANQETVFE-NIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDR---- 117
            |.:..:|:..|.||.:.: :..|.:....:.|::.|.|.|||||||||.|:||..:.:..:    
  Fly   218 FTYNVVFEPGATQEDILDYSGIKRIIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFVGKPNPK 282

Human   118 ----GIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDP 178
                |:|.|:..|:|:.::......|....|::|||||...|||:|.....     |........
  Fly   283 DPRHGLIFRSFLYLFQLIKNRKDVNYVLKASFMEIYNERVIDLLNPGSARK-----PLAVRWSKK 342

Human   179 DQNIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSATV-- 241
            .....::||........::.|.:|..|..||.:....||..|:|||.|.|:|:.|.:.....|  
  Fly   343 SGGFFVENLFTVDCEELDDLLAVLEEGMRNRAVGSHAMNDHSSRSHTILTVHILSDQQTDGGVFL 407

Human   242 -RHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSE--KHRSHIPYRNSMMT 303
             :|.|::.|||||||...||...|..|.||..||.||..|...|.:||:  |...|||||:|.:|
  Fly   408 SKHGKINFVDLAGSELTKKTMSEGKTLEEANNINKSLMVLGYCISSLSDSKKRTGHIPYRDSQLT 472

Human   304 SVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPR----LVIKR- 363
            .:|.|||.||.:|.|||.:|....|..|:::|.|:|.|...|:.:.|:  :::||    |.:|| 
  Fly   473 KLLADSLAGNGVTLMIACVSPAHYNHAETLNTLRYASRAKRIRTKPVI--KMDPREALILSLKRD 535

Human   364 ---LQKEIQELK------------------------DELAMVTGE-------QRTEALTEAELLQ 394
               ||.|...||                        |.::...|.       ||...|..:||.:
  Fly   536 IHALQMENDHLKAALNLHHQAAPNGGPVENLLELQLDRVSSGGGVPVPKVDLQRLPELDGSELAE 600

Human   395 LEKLITSFLEDQDSDSRLEVGADMRKV-HHCFHHLKKLLNDKKILENNTVSSESKDQDCQEPLKE 458
            |.||   ::.:.:|         :|:. :|.|...:.:|.|::|:             |:|  .|
  Fly   601 LVKL---YMVENES---------LRQENNHLFTVRETILRDQEIV-------------CRE--NE 638

Human   459 EEYRKLRDILK 469
            ...:||.|:.|
  Fly   639 RLLKKLEDVNK 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KIF6XP_005248961.1 Motor_domain 5..343 CDD:277568 115/361 (32%)
Kinesin 11..345 CDD:278646 114/357 (32%)
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 116/369 (31%)
KISc 166..512 CDD:276812 115/361 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.