DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR3A and robo2

DIOPT Version :9

Sequence 1:NP_001121064.2 Gene:FCGR3A / 2214 HGNCID:3619 Length:358 Species:Homo sapiens
Sequence 2:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster


Alignment Length:264 Identity:55/264 - (20%)
Similarity:93/264 - (35%) Gaps:61/264 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   134 LEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNE---SLISSQ------ASSYFIDAATVDDSG 189
            |||...||.:.:...::|.......:....|..|.   :|:.::      ..:..|..|...|.|
  Fly   193 LEPANTRVAQGEVALMECGAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGGNLAIQEARQSDDG 257

Human   190 EYRCQT-NL--STLSDPVQLEVHIGWLLLQAPR---------WVFK-------EEDPIHLRCHSW 235
            .|:|.. |:  :..|....|:||:...|::.|:         .||:       ..|.:..|..|.
  Fly   258 RYQCVVKNVVGTRESATAFLKVHVRPFLIRGPQNQTAVVGSSVVFQCRIGGDPLPDVLWRRTASG 322

Human   236 KNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAV 300
            .|..|.:|..|:          :....:...||:|.|.|.|       ...:....||.|..|.|
  Fly   323 GNMPLRRVHVLE----------DRSLKLDDVTLEDMGEYTC-------EADNAVGGITATGILTV 370

Human   301 STISSFFPPGYQV--SFCLVMV---LLFAVDTG------LYFSVKTNIRSSTRDWKDHKFKWRKD 354
            ..     ||.:.:  ...||.:   :||.....      ||:||:.|.......::|.:.:....
  Fly   371 HA-----PPKFVIRPKNQLVEIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVTLT 430

Human   355 PQDK 358
            |:.:
  Fly   431 PEGR 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR3ANP_001121064.2 None
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317
I-set 91..184 CDD:254352
I-set 190..279 CDD:254352 18/85 (21%)
Ig2_Robo 193..279 CDD:143201 18/85 (21%)
I-set 283..370 CDD:254352 21/103 (20%)
Ig 300..370 CDD:299845 19/86 (22%)
Ig 388..>457 CDD:299845 9/47 (19%)
I-set 479..561 CDD:254352
Ig 496..561 CDD:143165
FN3 588..681 CDD:238020
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.