DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR3A and ed

DIOPT Version :9

Sequence 1:NP_001121064.2 Gene:FCGR3A / 2214 HGNCID:3619 Length:358 Species:Homo sapiens
Sequence 2:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster


Alignment Length:354 Identity:69/354 - (19%)
Similarity:124/354 - (35%) Gaps:111/354 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    29 PPTLPPGSFL------------------PGPVLWW---GSLARLQTEKSDEVSRKGNWWVTEMGG 72
            ||.:.||:..                  |.|.:.|   ||...|.              .|.:.|
  Fly   152 PPVISPGNIAVATEDKPMELTCSSIGGSPDPTITWYREGSNTPLP--------------ATVLKG 202

Human    73 GAGERLFTSSCLVGLVPLGLRISLVTCPLQCGIMWQLLLPTALLLLVSAGMRTDLPKAVVFLEPQ 137
            |..::           |....:|::......|..::.::....:   :.|.|.:   |...|...
  Fly   203 GTKDQ-----------PTNATLSIIPRREDDGAKYKCVVRNRAM---NEGKRLE---ATATLNVN 250

Human   138 WY-RV---------LEKD-SVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEY 191
            :| ||         :|:| :..|:|.....|:..:.:|..|...||| :..:.|...:|.|:|:|
  Fly   251 YYPRVEVGPENPLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISS-SLVHTIHRVSVQDAGKY 314

Human   192 RC------------QTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVT 244
            .|            :..|..|..|:        :::::.....:|.|.:.:||:...|.|...:.
  Fly   315 TCIADNGLGKTGEQELILDILYPPM--------VVIESKTREAEEGDTVTIRCNVTANPAPVTIE 371

Human   245 YLQNGKGRKYFHHNSDFYIPKATLKD-SGSYFCR--------GLFGSKNVSSETVNITITQ---- 296
            :|:  :....|.:|.|.....:...| :|:|.||        |:..|:.|.:.||.:.:..    
  Fly   372 WLK--ENSPDFRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERVGNSTVALLVRHRPGQ 434

Human   297 ------------GLAVSTISSFFPPGYQV 313
                        |..|:...|..|||:.|
  Fly   435 AYITPNKPVVHVGNGVTLTCSANPPGWPV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR3ANP_001121064.2 None
edNP_001260013.1 Ig 50..147 CDD:299845
I-set 146..249 CDD:254352 20/127 (16%)
Ig 168..249 CDD:299845 16/111 (14%)
IGc2 268..323 CDD:197706 15/55 (27%)
Ig_3 341..406 CDD:290638 15/66 (23%)
Ig_2 437..514 CDD:290606 7/27 (26%)
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.