DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR3A and Fcgr3a

DIOPT Version :9

Sequence 1:NP_001121064.2 Gene:FCGR3A / 2214 HGNCID:3619 Length:358 Species:Homo sapiens
Sequence 2:NP_997486.2 Gene:Fcgr3a / 304966 RGDID:1303067 Length:249 Species:Rattus norvegicus


Alignment Length:253 Identity:151/253 - (59%)
Similarity:190/253 - (75%) Gaps:4/253 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   106 MWQLLLPTALLLLVSAGMRTDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESL 170
            ||.|||||||||.||:|:...|.||||.|:|:|.||||:|.|.|:|||.:|||||||:||||:||
  Rat     1 MWYLLLPTALLLTVSSGVGAGLQKAVVILDPEWVRVLEEDCVILRCQGTFSPEDNSTKWFHNKSL 65

Human   171 ISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSW 235
            ||.|.::|.|.:|.|.|||.|||||..|.|||||||:||..|||||..:.:|:|.|||.||||||
  Rat    66 ISHQDANYVIQSARVKDSGMYRCQTAFSALSDPVQLDVHADWLLLQTTKRLFQEGDPIRLRCHSW 130

Human   236 KNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAV 300
            :||.:.||||||||||:||||.||:..|.|||..|||||||||:.|..|:||.::.|:|..    
  Rat   131 RNTPVFKVTYLQNGKGKKYFHRNSELSISKATHADSGSYFCRGIIGRNNISSASLQISIGD---- 191

Human   301 STISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK 358
            .|..|.|.|.:|::|||::.||||:||.|||||:.:::||...:::.|..|.|:||||
  Rat   192 PTSPSSFLPWHQITFCLLIGLLFAIDTVLYFSVQRSLQSSVAVYEEPKLHWSKEPQDK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR3ANP_001121064.2 None
Fcgr3aNP_997486.2 Ig1_FcgammaR_like 25..103 CDD:409410 52/77 (68%)
Ig strand B 42..46 CDD:409410 2/3 (67%)
Ig strand C 56..60 CDD:409410 2/3 (67%)
Ig strand E 71..75 CDD:409410 1/3 (33%)
Ig strand F 85..90 CDD:409410 3/4 (75%)
Ig strand G 96..99 CDD:409410 2/2 (100%)
Ig2_FcgammaR_like 107..189 CDD:409411 52/81 (64%)
Ig strand B 123..127 CDD:409411 2/3 (67%)
Ig strand C 137..141 CDD:409411 3/3 (100%)
Ig strand E 154..158 CDD:409411 1/3 (33%)
Ig strand F 168..173 CDD:409411 4/4 (100%)
Ig strand G 182..185 CDD:409411 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83678852
Domainoid 1 1.000 108 1.000 Domainoid score I40911
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H477
Inparanoid 1 1.050 307 1.000 Inparanoid score I14532
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG34153
OrthoDB 1 1.010 - - D169543at9347
OrthoFinder 1 1.000 - - FOG0001730
OrthoInspector 1 1.000 - - otm52128
orthoMCL 1 0.900 - - OOG6_128259
Panther 1 1.100 - - LDO PTHR11481
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X79
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1414.410

Return to query results.
Submit another query.