DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR3A and XB5960289

DIOPT Version :9

Sequence 1:NP_001121064.2 Gene:FCGR3A / 2214 HGNCID:3619 Length:358 Species:Homo sapiens
Sequence 2:XP_002939044.1 Gene:XB5960289 / 100491172 XenbaseID:XB-GENE-5960290 Length:318 Species:Xenopus tropicalis


Alignment Length:185 Identity:57/185 - (30%)
Similarity:85/185 - (45%) Gaps:13/185 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   132 VFLEPQWYRVLEKDSVTLKCQGAYSPEDNST-QWFHNESLISSQASSYFIDAATVDDSGEYRCQT 195
            |..:|...::...:|:||.|..|...:...| .|:.:...||| ....||:||...:||.|:||.
 Frog    18 VSFQPDVGKIFFGESITLTCNVASPVQGTPTYSWYRDNKRISS-GQRLFINAALGANSGNYQCQA 81

Human   196 NLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSD 260
            ..|..||.|:|:|...::.||||..:: |.|.:.|||||....|.....:.::|...|....:|.
 Frog    82 GTSERSDAVKLKVTESYVTLQAPPTIY-EGDSLILRCHSAVFGASSGAVFYKDGTTLKSSTSDSA 145

Human   261 FYIPKATLKDSGSYFC-RGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVS 314
            ..:..|....||:|.| |.:|..:.|..|.:         :|....|..|..|||
 Frog   146 LSLGTAYRNASGTYRCSRNIFNDRPVIDEAL---------ISVKELFSKPQLQVS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR3ANP_001121064.2 None
XB5960289XP_002939044.1 Ig 16..94 CDD:299845 26/76 (34%)
Ig 101..165 CDD:299845 21/64 (33%)
Ig_2 186..273 CDD:290606 4/6 (67%)
IG_like 196..256 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I38779
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I13076
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277104at7742
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11481
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X79
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.