DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR3A and si:cabz01036022.1

DIOPT Version :9

Sequence 1:NP_001121064.2 Gene:FCGR3A / 2214 HGNCID:3619 Length:358 Species:Homo sapiens
Sequence 2:XP_017212447.1 Gene:si:cabz01036022.1 / 100003349 ZFINID:ZDB-GENE-160113-144 Length:741 Species:Danio rerio


Alignment Length:232 Identity:58/232 - (25%)
Similarity:91/232 - (39%) Gaps:54/232 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   110 LLPTALLLLVSAGMRT----DLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESL 170
            |.|..|:||:.||:.:    :.|||||.::|      :|...|::|:...:.:|.:..|....|.
Zfish     3 LSPLPLMLLLIAGILSGHAEERPKAVVIVDP------DKHERTVRCEIPGADDDWTYSWVKEGST 61

Human   171 IS-SQASSYFIDAATVDDSGEYRCQTNL------STLSDPVQLEVHI------GWLLLQAPRWVF 222
            .. |:...:.|.......|....|:.|.      |.:||.|.|.:.:      .:|.:|:.....
Zfish    62 KPFSRDREFSISTGVSHSSSNVTCRGNSPDRSLESEISDAVTLNLSVPTESYKAFLTVQSELSQI 126

Human   223 KEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYF------HHNSD---FYIPKATLKDSGSYFCRG 278
            ..||.:.|.|.             ..|:.|||.      .|.||   |.|...:.:....|..| 
Zfish   127 LREDTVTLTCD-------------VQGENRKYIFRCGDEEHESDEEEFRIRVKSTQTCKCYSWR- 177

Human   279 LFGSKNVSSETVNITI------TQG-LAVSTISSFFP 308
            ..|:...|:| ||:|:      |:| .||.|:....|
Zfish   178 QSGTSEWSNE-VNLTVSDMKVPTEGPKAVLTVHPELP 213



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11481
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X79
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.