DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR2B and ed

DIOPT Version :9

Sequence 1:XP_024309811.1 Gene:FCGR2B / 2213 HGNCID:3618 Length:324 Species:Homo sapiens
Sequence 2:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster


Alignment Length:383 Identity:74/383 - (19%)
Similarity:118/383 - (30%) Gaps:140/383 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    47 PPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNND---- 107
            ||..|  :|.:.....:.|:||:.|..|.:|...:|:|....:       |.:|:   |.|    
  Fly   337 PPMVV--IESKTREAEEGDTVTIRCNVTANPAPVTIEWLKENS-------PDFRY---NGDVLTL 389

Human   108 -------SGEYTCQTGQTSLSDPVHLT--VLSEWLVLQTPHLEFQE-----------GETIVLRC 152
                   :|.|.|:......|..:..:  |.:..:.|...|...|.           |..:.|.|
  Fly   390 TSVRADHAGNYICRAVNIMQSQGMERSERVGNSTVALLVRHRPGQAYITPNKPVVHVGNGVTLTC 454

Human   153 HS----WKDKPLVKVTFFQN-----GKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSK 208
            .:    |   |:.:..:|::     ..::|.....|.:|||:|:..:.|.|||            
  Fly   455 SANPPGW---PVPQYRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEGKYHC------------ 504

Human   209 PVTITVQAPSSSPMGIIVAVVTGI------------AVAAIVAAVVALIYCRKKRISALPGYPEC 261
                  .|.:...:|::..:|..|            .:...||.....:.|..|...| |.....
  Fly   505 ------HAVNELGIGMMATIVLEIHQPPQFLAKLQQHMTRRVADTDYTVTCSAKGKPA-PSVKWL 562

Human   262 REMGETLPEKPGEYRLSQGFSDGSPGL--------------PAG--LEPGRRGL----------- 299
            ::..|.|||: ..|.:......|..|:              |.|  |.||.|||           
  Fly   563 KDAVEILPEE-NLYEVQTNPDQGLNGMVTVQSQLKFRGKARPNGNALVPGDRGLYTCLYQNEVNS 626

Human   300 ---------------------------------CKFSWEPGREQQWEDGWGSNRLVSS 324
                                             ||....|..|.||:.|...:.|..|
  Fly   627 ANSSMQLRIEHEPIVLHQYNKVAFDIRETAEVVCKVQAYPKPEFQWQFGNNPSPLTMS 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR2BXP_024309811.1 Ig1_FcgammaR_like 50..128 CDD:143229 18/90 (20%)
Ig2_FcgammaR_like 132..214 CDD:319307 19/101 (19%)
edNP_001260013.1 Ig 50..147 CDD:299845
I-set 146..249 CDD:254352
Ig 168..249 CDD:299845
IGc2 268..323 CDD:197706
Ig_3 341..406 CDD:290638 17/76 (22%)
Ig_2 437..514 CDD:290606 17/97 (18%)
I-set 526..633 CDD:254352 21/108 (19%)
Ig 546..632 CDD:143165 19/87 (22%)
IG_like 654..736 CDD:214653 9/31 (29%)
Ig 656..734 CDD:143165 9/29 (31%)
FN3 741..848 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.