DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR2B and Fcgr2b

DIOPT Version :9

Sequence 1:XP_024309811.1 Gene:FCGR2B / 2213 HGNCID:3618 Length:324 Species:Homo sapiens
Sequence 2:XP_006250295.1 Gene:Fcgr2b / 289211 RGDID:631331 Length:342 Species:Rattus norvegicus


Alignment Length:328 Identity:173/328 - (52%)
Similarity:218/328 - (66%) Gaps:10/328 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQED 65
            ||.|.|||:....:........:...|||||||||.|  ||.:.|..||||:||||.||.||:||
  Rat     1 MGTLLFLPLPMDSNRTVVHVLSRTLYHMLLWTAVLNL--VAESHAGLPKAVVKLEPPWIQVLKED 63

Human    66 SVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLS 130
            :|||.|.|||:.::.|.||||||:.|....|.:|.|||..||||||.|:..:|.:|:|:||.|:|
  Rat    64 TVTLMCEGTHNTKNCSTQWFHNGSSIWHQAQANYTFKATVNDSGEYRCRMEETGISEPIHLGVIS 128

Human   131 EWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYH 195
            :||:|||..|.|:|||||.|||||||:|.|.||..|||||..::.....|||||:|||||||:|:
  Rat   129 DWLLLQTSQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYHQSSNFSIPKANHSHSGNYY 193

Human   196 CTGNIGYTLYSSKPVTITVQAPSSS---PMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPG 257
            |...:|.|::.|||||||||.|.||   |:..|||.|.||||||||..:|:|:|.:||::.||||
  Rat   194 CKAYLGRTMHVSKPVTITVQEPKSSSSLPVLTIVAAVAGIAVAAIVIILVSLVYLKKKQVPALPG 258

Human   258 YPECREMGETLPEKPGEYRLSQGFS-DGSPGLPAGLEPGRRGLCKFSWEPGREQQWEDGWGSNRL 321
            .|:.|||||.|||:.||||...|.| ..|||.|:||:|.|..    |:.|...::.|.....|.:
  Rat   259 NPDHREMGEALPEELGEYRKPSGGSVPVSPGPPSGLDPTRSS----SYTPSGLEEAEKNEVENTI 319

Human   322 VSS 324
            ..|
  Rat   320 TYS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR2BXP_024309811.1 Ig1_FcgammaR_like 50..128 CDD:143229 44/77 (57%)
Ig2_FcgammaR_like 132..214 CDD:319307 50/81 (62%)
Fcgr2bXP_006250295.1 Ig 48..126 CDD:299845 44/77 (57%)
IG_like 54..112 CDD:214653 33/57 (58%)
Ig2_FcgammaR_like 130..212 CDD:143230 50/81 (62%)
IG_like 136..212 CDD:214653 45/75 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83678855
Domainoid 1 1.000 112 1.000 Domainoid score I40068
eggNOG 1 0.900 - - E1_2ESZP
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2974
Inparanoid 1 1.050 297 1.000 Inparanoid score I14652
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG34347
OrthoDB 1 1.010 - - D1246375at2759
OrthoFinder 1 1.000 - - FOG0001730
OrthoInspector 1 1.000 - - mtm10029
orthoMCL 1 0.900 - - OOG6_120517
Panther 1 1.100 - - O PTHR11481
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X79
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.270

Return to query results.
Submit another query.