DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR2B and XB5960289

DIOPT Version :10

Sequence 1:NP_003992.3 Gene:FCGR2B / 2213 HGNCID:3618 Length:310 Species:Homo sapiens
Sequence 2:XP_002939044.1 Gene:XB5960289 / 100491172 XenbaseID:XB-GENE-5960290 Length:318 Species:Xenopus tropicalis


Alignment Length:200 Identity:59/200 - (29%)
Similarity:94/200 - (47%) Gaps:20/200 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    28 MLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSP--ESDSIQWFHNGNL 90
            |:....:||:. |..||      .:..:|....:...:|:|||| ...||  .:.:..|:.:...
 Frog     1 MIALVMLLFVC-VTATP------WVSFQPDVGKIFFGESITLTC-NVASPVQGTPTYSWYRDNKR 57

Human    91 IPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSW 155
            | :..|..:...|...:||.|.||.|.:..||.|.|.|...::.||.|...: ||::::|||||.
 Frog    58 I-SSGQRLFINAALGANSGNYQCQAGTSERSDAVKLKVTESYVTLQAPPTIY-EGDSLILRCHSA 120

Human   156 KDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPV----TITVQA 216
            .........|:::|.:.|.|.||...|:..|..:.||.|.|:.||    ::.:||    .|:|:.
 Frog   121 VFGASSGAVFYKDGTTLKSSTSDSALSLGTAYRNASGTYRCSRNI----FNDRPVIDEALISVKE 181

Human   217 PSSSP 221
            ..|.|
 Frog   182 LFSKP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR2BNP_003992.3 Ig1_FcgammaR_like 50..128 CDD:409410 22/79 (28%)
Ig strand A 51..54 CDD:409410 0/2 (0%)
Ig strand A' 59..62 CDD:409410 0/2 (0%)
Ig strand B 66..72 CDD:409410 4/5 (80%)
Ig strand C 82..87 CDD:409410 1/4 (25%)
Ig strand C' 89..91 CDD:409410 0/1 (0%)
Ig strand E 97..102 CDD:409410 0/4 (0%)
Ig strand F 109..114 CDD:409410 2/4 (50%)
Ig strand G 122..128 CDD:409410 3/5 (60%)
Ig2_FcgammaR_like 132..214 CDD:409411 27/85 (32%)
Ig strand A 132..136 CDD:409411 0/3 (0%)
Ig strand A' 141..143 CDD:409411 0/1 (0%)
Ig strand B 147..154 CDD:409411 3/6 (50%)
Ig strand C 161..167 CDD:409411 1/5 (20%)
Ig strand C' 170..175 CDD:409411 1/4 (25%)
Ig strand E 179..183 CDD:409411 0/3 (0%)
Ig strand F 193..198 CDD:409411 2/4 (50%)
Ig strand G 204..214 CDD:409411 3/13 (23%)
ITIM motif 290..295
XB5960289XP_002939044.1 Ig 16..94 CDD:472250 23/85 (27%)
Ig strand B 33..37 CDD:409353 2/3 (67%)
Ig strand C 47..52 CDD:409353 0/4 (0%)
Ig strand E 63..66 CDD:409353 0/2 (0%)
Ig strand F 76..81 CDD:409353 2/4 (50%)
Ig strand G 87..90 CDD:409353 2/2 (100%)
Ig 100..165 CDD:472250 22/65 (34%)
Ig strand B 113..117 CDD:409353 1/3 (33%)
Ig strand C 127..131 CDD:409353 0/3 (0%)
Ig strand E 144..148 CDD:409353 0/3 (0%)
Ig strand F 158..163 CDD:409353 2/4 (50%)
Ig_3 185..256 CDD:464046 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.