| Sequence 1: | NP_003992.3 | Gene: | FCGR2B / 2213 | HGNCID: | 3618 | Length: | 310 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002939044.1 | Gene: | XB5960289 / 100491172 | XenbaseID: | XB-GENE-5960290 | Length: | 318 | Species: | Xenopus tropicalis |
| Alignment Length: | 200 | Identity: | 59/200 - (29%) |
|---|---|---|---|
| Similarity: | 94/200 - (47%) | Gaps: | 20/200 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Human 28 MLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSP--ESDSIQWFHNGNL 90
Human 91 IPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSW 155
Human 156 KDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPV----TITVQA 216
Human 217 PSSSP 221 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| FCGR2B | NP_003992.3 | Ig1_FcgammaR_like | 50..128 | CDD:409410 | 22/79 (28%) |
| Ig strand A | 51..54 | CDD:409410 | 0/2 (0%) | ||
| Ig strand A' | 59..62 | CDD:409410 | 0/2 (0%) | ||
| Ig strand B | 66..72 | CDD:409410 | 4/5 (80%) | ||
| Ig strand C | 82..87 | CDD:409410 | 1/4 (25%) | ||
| Ig strand C' | 89..91 | CDD:409410 | 0/1 (0%) | ||
| Ig strand E | 97..102 | CDD:409410 | 0/4 (0%) | ||
| Ig strand F | 109..114 | CDD:409410 | 2/4 (50%) | ||
| Ig strand G | 122..128 | CDD:409410 | 3/5 (60%) | ||
| Ig2_FcgammaR_like | 132..214 | CDD:409411 | 27/85 (32%) | ||
| Ig strand A | 132..136 | CDD:409411 | 0/3 (0%) | ||
| Ig strand A' | 141..143 | CDD:409411 | 0/1 (0%) | ||
| Ig strand B | 147..154 | CDD:409411 | 3/6 (50%) | ||
| Ig strand C | 161..167 | CDD:409411 | 1/5 (20%) | ||
| Ig strand C' | 170..175 | CDD:409411 | 1/4 (25%) | ||
| Ig strand E | 179..183 | CDD:409411 | 0/3 (0%) | ||
| Ig strand F | 193..198 | CDD:409411 | 2/4 (50%) | ||
| Ig strand G | 204..214 | CDD:409411 | 3/13 (23%) | ||
| ITIM motif | 290..295 | ||||
| XB5960289 | XP_002939044.1 | Ig | 16..94 | CDD:472250 | 23/85 (27%) |
| Ig strand B | 33..37 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 47..52 | CDD:409353 | 0/4 (0%) | ||
| Ig strand E | 63..66 | CDD:409353 | 0/2 (0%) | ||
| Ig strand F | 76..81 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 87..90 | CDD:409353 | 2/2 (100%) | ||
| Ig | 100..165 | CDD:472250 | 22/65 (34%) | ||
| Ig strand B | 113..117 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 127..131 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 144..148 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 158..163 | CDD:409353 | 2/4 (50%) | ||
| Ig_3 | 185..256 | CDD:464046 | 0/1 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||