DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR2A and Fcgr2b

DIOPT Version :9

Sequence 1:XP_011507589.1 Gene:FCGR2A / 2212 HGNCID:3616 Length:369 Species:Homo sapiens
Sequence 2:XP_006250295.1 Gene:Fcgr2b / 289211 RGDID:631331 Length:342 Species:Rattus norvegicus


Alignment Length:291 Identity:141/291 - (48%)
Similarity:184/291 - (63%) Gaps:14/291 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    10 NVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQ 74
            :|..|.|:.:...|.:|.|. |:|.|.. ||||:|||||||.||:||:|||.|:|..:.::.|.|
  Rat    19 HVLSRTLYHMLLWTAVLNLV-AESHAGL-PKAVVKLEPPWIQVLKEDTVTLMCEGTHNTKNCSTQ 81

Human    75 WFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETI 139
            |||||:.|....|.:|.|||..||||||.|:..:|.:|:|:||.|:|:||:|||..|.|:|||||
  Rat    82 WFHNGSSIWHQAQANYTFKATVNDSGEYRCRMEETGISEPIHLGVISDWLLLQTSQLVFEEGETI 146

Human   140 MLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTIT 204
            .|||||||:|.|.||..|||||..::.|....||||:|||||||:|:|...:|.|:..|||||||
  Rat   147 TLRCHSWKNKQLTKVLLFQNGKPVRYYHQSSNFSIPKANHSHSGNYYCKAYLGRTMHVSKPVTIT 211

Human   205 VQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAI 269
            ||.|...||.|:..|||.|...||||||..:|:|:|.:||:        |.|....|..|:|   
  Rat   212 VQEPKSSSSLPVLTIVAAVAGIAVAAIVIILVSLVYLKKKQ--------VPALPGNPDHREM--- 265

Human   270 RKRQLEETNNDYETADGGYMTLNPRAPTDDD 300
             ...|.|...:|....||.:.::|..|:..|
  Rat   266 -GEALPEELGEYRKPSGGSVPVSPGPPSGLD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR2AXP_011507589.1 Ig1_FcgammaR_like 41..119 CDD:143229 43/77 (56%)
IG_like 47..119 CDD:214653 38/71 (54%)
Ig2_FcgammaR_like 123..205 CDD:143230 50/81 (62%)
IG_like 129..205 CDD:214653 45/75 (60%)
Fcgr2bXP_006250295.1 Ig 48..126 CDD:299845 43/77 (56%)
IG_like 54..112 CDD:214653 32/57 (56%)
Ig2_FcgammaR_like 130..212 CDD:143230 50/81 (62%)
IG_like 136..212 CDD:214653 45/75 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83678856
Domainoid 1 1.000 112 1.000 Domainoid score I40068
eggNOG 1 0.900 - - E1_2ESZP
HGNC 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 297 1.000 Inparanoid score I14652
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG34347
OrthoDB 1 1.010 - - D1246375at2759
OrthoFinder 1 1.000 - - FOG0001730
OrthoInspector 1 1.000 - - mtm10029
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11481
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X79
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.