DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR2A and Dscam4

DIOPT Version :9

Sequence 1:XP_011507589.1 Gene:FCGR2A / 2212 HGNCID:3616 Length:369 Species:Homo sapiens
Sequence 2:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster


Alignment Length:351 Identity:72/351 - (20%)
Similarity:128/351 - (36%) Gaps:81/351 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    30 SADSQAAAPPKAVLKLEPPWINVLQED-SVTLTCQGARSPESDSIQWFHNGN-LIPTHTQPSYRF 92
            :.:.|...||| ::.:: ...|:|:|. ...::||........|.:|..||. ||.|..:...|.
  Fly   602 NVEIQVLVPPK-IMPIQ-AMTNMLREGMRAAISCQILEGDLPVSFRWERNGKPLIGTGNEVFRRL 664

Human    93 ----------KANNNDSGEYTC----QTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRC 143
                      ..:::.||.|||    ..|....:.|:.:.|..:| :|:......|.|..::|.|
  Fly   665 DEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKW-ILEPKDSSAQAGADVLLHC 728

Human   144 HS---------WKD--------------KPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDY 185
            .|         ||.              :|.|::  |.||          |....:.:....|.:
  Fly   729 QSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQL--FPNG----------TIFFKKISKESQGHF 781

Human   186 HC--TGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISA 248
            .|  ..|||..:  ||.:.:.|.||:...:....|.||......|...|.....:.:..|.:.:.
  Fly   782 LCEAKNNIGSGV--SKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQATQ 844

Human   249 NSTDPVKAAQFEPPGRQMIAIRKRQLEE-------TNNDYETADGGYMTLNPRAPTDDDKNIYLT 306
            ...|....:::        .||.:.|::       .::.|....|.|:.....|...|:.:|.|.
  Fly   845 QYLDESLDSRY--------TIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLI 901

Human   307 L------PPNDHVNT--NKAFTLFWN 324
            :      |.|..:|:  :::..|.|:
  Fly   902 VQEVPEQPKNLRINSQQSRSLQLTWS 927

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
FCGR2AXP_011507589.1 Ig1_FcgammaR_like 41..119 CDD:143229 20/93 (22%)
IG_like 47..119 CDD:214653 20/87 (23%)
Ig2_FcgammaR_like 123..205 CDD:143230 22/106 (21%)
IG_like 129..205 CDD:214653 20/100 (20%)
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549
Ig strand F 397..402 CDD:409549
Ig strand G 410..413 CDD:409549
IgI_4_Dscam 422..516 CDD:409548
Ig strand B 439..443 CDD:409548
Ig strand C 452..456 CDD:409548
Ig strand E 482..486 CDD:409548
Ig strand F 496..501 CDD:409548
Ig strand G 509..512 CDD:409548
IgI_5_Dscam 520..607 CDD:409550 0/4 (0%)
Ig strand B 536..540 CDD:409550
Ig strand C 549..553 CDD:409550
Ig strand E 571..575 CDD:409550
Ig strand F 586..591 CDD:409550