DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR2A and Fcgr2b

DIOPT Version :9

Sequence 1:XP_011507589.1 Gene:FCGR2A / 2212 HGNCID:3616 Length:369 Species:Homo sapiens
Sequence 2:NP_001070657.1 Gene:Fcgr2b / 14130 MGIID:95499 Length:340 Species:Mus musculus


Alignment Length:290 Identity:146/290 - (50%)
Similarity:183/290 - (63%) Gaps:20/290 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     8 SQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDS 72
            |:.:|...||     |.:|.||:.....   ||||:|||||||.||:||:|||||:|..:|.:.|
Mouse    21 SRTLCHMLLW-----TAVLNLAAGTHDL---PKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSS 77

Human    73 IQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGE 137
            .||||||..|.:..|.||.|||..||||||.||..||.|||||.|.|:|:||:||||.|.|.|||
Mouse    78 TQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGE 142

Human   138 TIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVT 202
            ||.||||||::|.|.:::||.|.||.::.|....||||:|||||||||:|.|::|.||..|||||
Mouse   143 TITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVT 207

Human   203 ITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMI 267
            ||||.|....|.|:..|||.|...||||||..:|:|:|.:||:        |.|....|..|:| 
Mouse   208 ITVQGPKSSRSLPVLTIVAAVTGIAVAAIVIILVSLVYLKKKQ--------VPALPGNPDHREM- 263

Human   268 AIRKRQLEETNNDYETADGGYMTLNPRAPT 297
               ...|.|...:|....||.:.::|..|:
Mouse   264 ---GETLPEEVGEYRQPSGGSVPVSPGPPS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR2AXP_011507589.1 Ig1_FcgammaR_like 41..119 CDD:143229 50/77 (65%)
IG_like 47..119 CDD:214653 45/71 (63%)
Ig2_FcgammaR_like 123..205 CDD:143230 51/81 (63%)
IG_like 129..205 CDD:214653 46/75 (61%)
Fcgr2bNP_001070657.1 Ig 46..124 CDD:299845 50/77 (65%)
IG_like 52..110 CDD:214653 35/57 (61%)
Ig2_FcgammaR_like 128..210 CDD:143230 51/81 (63%)
IG_like 134..210 CDD:214653 46/75 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83953381
Domainoid 1 1.000 113 1.000 Domainoid score I42125
eggNOG 1 0.900 - - E1_2ESZP
HGNC 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 341 1.000 Inparanoid score I14570
Isobase 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG34347
OrthoDB 1 1.010 - - D1246375at2759
OrthoFinder 1 1.000 - - FOG0001730
OrthoInspector 1 1.000 - - mtm9907
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11481
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X79
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.