DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tssk2 and CG9222

DIOPT Version :9

Sequence 1:NP_033462.2 Gene:Tssk2 / 22115 MGIID:1347559 Length:358 Species:Mus musculus
Sequence 2:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster


Alignment Length:271 Identity:120/271 - (44%)
Similarity:183/271 - (67%) Gaps:3/271 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 VLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHR 70
            :|.:.|.|:|..:|.|:|||||..:||.....||||||.:.|.|:::.::|||||::.:..::|.
  Fly    70 ILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHE 134

Mouse    71 SIIKTYEIFETSDGRIYIVMELGVQGDLLEFIKCRGALHEDVARKMFRQLSSAVKYCHDLDVVHR 135
            ::|..|:..|||. |:|::|:|...|.||::::.|..|.|..:|.:|:||.|||:|.|...||||
  Fly   135 NLITFYQSIETSH-RVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHR 198

Mouse   136 DLKCENLLLDKDFNIKLSDFGFSKRCLRDGSGRIVLSKTFCGSAAYAAPEVLQGIPYQPKVYDIW 200
            |:||||||||:::|:||.||||:::..|....:::||||||||.|||:||:|:|:.|.|.:.|||
  Fly   199 DIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIW 263

Mouse   201 SLGVILYIMVCGSMPYDDSDIKKMLRIQKEHRVDFPRSKNLTGECKDLIYRILQPDVNRRLHIDE 265
            :.||:.|.||.|.:|||.|::..:|:...:..| ||:|.:.:.|||.:|..||.| |..|.:|.:
  Fly   264 ACGVVCYAMVFGRLPYDGSNVHILLKRINQSLV-FPKSPSASSECKHMIMHILAP-VKIRYNIPQ 326

Mouse   266 ILSHSWLQPPK 276
            :....|..|.|
  Fly   327 VKEDPWYSPSK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tssk2NP_033462.2 STKc_TSSK1_2-like 10..272 CDD:271067 116/261 (44%)
S_TKc 12..272 CDD:214567 115/259 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..358
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 116/260 (45%)
S_TKc 78..332 CDD:214567 114/256 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 1 1.000 - - FOG0007569
OrthoInspector 1 1.000 - - otm43332
orthoMCL 1 0.900 - - OOG6_103794
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.