DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPA3 and SLIRP1

DIOPT Version :10

Sequence 1:NP_919223.1 Gene:HNRNPA3 / 220988 HGNCID:24941 Length:378 Species:Homo sapiens
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:78 Identity:22/78 - (28%)
Similarity:47/78 - (60%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   124 TVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY 188
            :|.:||||.:........||.||.::|::.:..|:.|:::|..:|:.||:|:....::||..::.
  Fly    13 SVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQK 77

Human   189 HTINGHNCEVKKA 201
            |.:.|:...::|:
  Fly    78 HILEGNYLNIQKS 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPA3NP_919223.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
RRM1_hnRNPA_like 36..113 CDD:409992
RRM2_hnRNPA3 126..205 CDD:409996 21/76 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225
HnRNPA1 331..>347 CDD:463312
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..378
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.