DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph1 and CG14490

DIOPT Version :9

Sequence 1:NP_079566.1 Gene:Rsph1 / 22092 MGIID:1194909 Length:301 Species:Mus musculus
Sequence 2:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster


Alignment Length:158 Identity:56/158 - (35%)
Similarity:91/158 - (57%) Gaps:11/158 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 GEYEGERNEVGER-HGHGKARLPNGDTYEGSYEFGKRHGQGTYKFK--NGAR---YTGDYVKNKK 76
            |:|:|:  .:|:: ||.|..:..:|..|||.::.|:|||.|:.:.|  :|..   |.|.:.:||:
  Fly    20 GQYQGK--WLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKR 82

Mouse    77 HGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTW 141
            .|:|...|||||.|.|:|..|||.|:|:.:..:...|.|||...:.|.:| .|:..||::|||.:
  Fly    83 SGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKG-LLFTATGNRYVGQF 146

Mouse   142 VHGQQEGAAELIHLNH--RYQGKFMNKN 167
            ..|.:.|:....|.::  |.|..|.:|:
  Fly   147 EGGCKSGSGVFYHASNGQRIQHGFWSKD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph1NP_079566.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 7/23 (30%)
MORN 1 20..43 7/23 (30%)
COG4642 37..172 CDD:226989 49/138 (36%)
MORN 42..63 CDD:197832 9/22 (41%)
MORN 2 44..66 10/23 (43%)
MORN 67..89 CDD:280628 10/21 (48%)
MORN 3 67..89 10/21 (48%)
MORN 88..109 CDD:197832 9/20 (45%)
MORN 4 90..112 8/21 (38%)
MORN 111..131 CDD:197832 7/19 (37%)
MORN 5 113..135 8/21 (38%)
MORN 6 159..181 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..301
CG14490NP_611274.1 COG4642 35..170 CDD:226989 48/135 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.