| Sequence 1: | NP_001365733.1 | Gene: | FCGR1A / 2209 | HGNCID: | 3613 | Length: | 375 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001260013.1 | Gene: | ed / 33619 | FlyBaseID: | FBgn0000547 | Length: | 1332 | Species: | Drosophila melanogaster |
| Alignment Length: | 268 | Identity: | 66/268 - (24%) |
|---|---|---|---|
| Similarity: | 108/268 - (40%) | Gaps: | 32/268 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Human 34 VFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRC--QRGL--SGRS 94
Human 95 DPIQLEIHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSN-LTILK 158
Human 159 TNISHNGTYHC------SGMGKHRYTSAGISVTVKELFPAPVLNASVT--SPLLE-GNLVTLSCE 214
Human 215 TKLLLQRPGLQLYFSFYMGSKTLRGRNTSS--------EYQILTARREDSGLYWCEAATEDGNVL 271
Human 272 KRSPELEL 279 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| FCGR1A | NP_001365733.1 | Ig1_FcgammaR_like | 23..101 | CDD:409410 | 21/70 (30%) |
| Ig strand B | 40..44 | CDD:409410 | 1/3 (33%) | ||
| Ig strand C | 54..58 | CDD:409410 | 0/3 (0%) | ||
| Ig strand E | 69..73 | CDD:409410 | 0/3 (0%) | ||
| Ig strand F | 83..88 | CDD:409410 | 2/6 (33%) | ||
| Ig strand G | 94..97 | CDD:409410 | 0/2 (0%) | ||
| Ig2_FcgammaR_like | 105..186 | CDD:409411 | 17/87 (20%) | ||
| Ig strand B | 121..125 | CDD:409411 | 0/3 (0%) | ||
| Ig strand C | 135..139 | CDD:409411 | 0/3 (0%) | ||
| Ig strand E | 152..156 | CDD:409411 | 1/4 (25%) | ||
| Ig strand F | 166..171 | CDD:409411 | 2/10 (20%) | ||
| Ig strand G | 179..182 | CDD:409411 | 0/2 (0%) | ||
| ig | 197..275 | CDD:395002 | 23/88 (26%) | ||
| Interaction with EPB41L2. /evidence=ECO:0000269|PubMed:18023480 | 313..333 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 353..375 | ||||
| ed | NP_001260013.1 | Ig | 50..147 | CDD:299845 | |
| I-set | 146..249 | CDD:254352 | |||
| Ig | 168..249 | CDD:299845 | |||
| IGc2 | 268..323 | CDD:197706 | 17/55 (31%) | ||
| Ig_3 | 341..406 | CDD:290638 | 13/66 (20%) | ||
| Ig_2 | 437..514 | CDD:290606 | 22/82 (27%) | ||
| I-set | 526..633 | CDD:254352 | |||
| Ig | 546..632 | CDD:143165 | |||
| IG_like | 654..736 | CDD:214653 | |||
| Ig | 656..734 | CDD:143165 | |||
| FN3 | 741..848 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||