DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsg101 and TSG101

DIOPT Version :9

Sequence 1:NP_068684.1 Gene:Tsg101 / 22088 MGIID:106581 Length:391 Species:Mus musculus
Sequence 2:NP_524120.1 Gene:TSG101 / 39881 FlyBaseID:FBgn0036666 Length:408 Species:Drosophila melanogaster


Alignment Length:414 Identity:204/414 - (49%)
Similarity:272/414 - (65%) Gaps:36/414 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 AVSESQLKKMMSKYKYRDLTVRQTVNVIAMYKDLKPVLDSYVFNDGSSRELVNLTGTIPVRYRGN 66
            ||.|:|:.|.:|||||...|.:..|:|:..::.|...|..:|||||||:||..:.|||||.|:.|
  Fly     3 AVEETQITKYLSKYKYVAATKKDVVDVVTSFRSLTYDLQRFVFNDGSSKELFTIQGTIPVVYKNN 67

Mouse    67 IYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHDWKHPRSELLELIQIM 131
            .|.||||:||:||:|.|.|:||||||.:|.||...:||.|||:||||||||:...|:||.|||:|
  Fly    68 TYYIPICIWLMDTHPQNAPMCFVKPTPTMQIKVSMYVDHNGKVYLPYLHDWQPHSSDLLSLIQVM 132

Mouse   132 IVIFGEEPPVFSRP--TVSASYPPYTATGPPNTSYM--PGMPSGISA---YP-------SGYPPN 182
            ||.||:.|||:|:|  .::|.|        |..|||  ||.|.|.::   ||       |.:||.
  Fly   133 IVTFGDHPPVYSKPKEQIAAPY--------PTNSYMPQPGAPGGSNSFLPYPTAGGAGGSNFPPY 189

Mouse   183 PSGYPGCPYP--PAGP-----YPA------TTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISA 234
            |:|....|||  ||||     |||      .|:..||.........||..|||:|:.|:||:|||
  Fly   190 PTGSNVGPYPPTPAGPAGGSGYPAYPNFIQPTAGGYPPAAGYNPSNPSSTGTITEEHIKASIISA 254

Mouse   235 VSDKLRWRMKEEMDGAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEEL 299
            :.||||.|::|:::..|||:..|.||:::|.:|..|::.::.||::|..::.|||.:||.|::||
  Fly   255 IDDKLRRRVQEKVNQYQAEIETLNRTKQELLEGSAKIDAIIERLEREHIDMQKNISILKDKEQEL 319

Mouse   300 SSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHV 364
            ..|||.:|:....|. ||.:..|||||:|:||.||:|.|.||.|:||||.||.|||||:.|||||
  Fly   320 EKALEDLESAEAINP-DEAVTTTAPLYRQLLNAYADEAATEDAIYYLGEGLRGGVIDLETFLKHV 383

Mouse   365 RLLSRKQFQLRALMQKARKTAGLS 388
            |.||||||.|||.|||.|:.|||:
  Fly   384 RQLSRKQFILRATMQKCRQKAGLA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsg101NP_068684.1 UEV 21..139 CDD:399041 66/117 (56%)
Interaction with CEP55. /evidence=ECO:0000250 159..163 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..220 8/28 (29%)
SMC_prok_B <242..>384 CDD:274008 74/141 (52%)
Vps23_core 317..376 CDD:401418 40/58 (69%)
PTAP/PSAP motif 321..324 1/2 (50%)
TSG101NP_524120.1 UEV 22..140 CDD:283415 66/117 (56%)
ARS2 <149..227 CDD:282772 29/85 (34%)
TBPIP <242..353 CDD:284512 49/111 (44%)
Vps23_core 336..393 CDD:286532 39/56 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838110
Domainoid 1 1.000 154 1.000 Domainoid score I4259
eggNOG 1 0.900 - - E1_KOG2391
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4584
Inparanoid 1 1.050 375 1.000 Inparanoid score I2070
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54978
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001267
OrthoInspector 1 1.000 - - oto94572
orthoMCL 1 0.900 - - OOG6_102944
Panther 1 1.100 - - LDO PTHR23306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5678
SonicParanoid 1 1.000 - - X3220
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.