DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCER1A and CG34353

DIOPT Version :9

Sequence 1:NP_001374209.1 Gene:FCER1A / 2205 HGNCID:3609 Length:257 Species:Homo sapiens
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:213 Identity:52/213 - (24%)
Similarity:86/213 - (40%) Gaps:49/213 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    40 RIFKGENVTLTCN--GNNFFEVSSTKWFHNGSL----SEETNSS-LNIVNAKFEDSGEYKC-QHQ 96
            ::.||.:|.:.|:  ||   .:.:..|....::    .|:.:|. |:|.|......|.|.| .:.
  Fly   194 QVKKGSSVRIECSATGN---PMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTANN 255

Human    97 QVNE--SEPVYLEV-FSDWLLLQASAEVVMEGQPLFLRC--HGWRNWDVYKVIYYKDGEAL---- 152
            :|.:  |..|.|.| ||..:.::.......||....|.|  ||...   .:||::||...|    
  Fly   256 RVGQPASSQVVLHV
LFSPEISVERPVVFSGEGHEATLVCIVHGETQ---PEVIWFKDTMQLDTTE 317

Human   153 KYWYE----NHNISITNATVEDSGTYYCT-----GKVWQ-LDYESEPLNITVIKAP-----REKY 202
            ::..|    .|.:.|.....:|.|.|.|.     ||..: |....:| |:.|..:|     :::|
  Fly   318 RHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKP-NVAVFNSPPISQYKDRY 381

Human   203 WLQFFIPLLVVILFAVDT 220
                      .|.:|||:
  Fly   382 ----------NISWAVDS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCER1ANP_001374209.1 Ig1_FcgammaR_like 30..108 CDD:409410 19/77 (25%)
Ig strand B 47..51 CDD:409410 1/3 (33%)
Ig strand C 61..65 CDD:409410 0/3 (0%)
Ig strand E 76..80 CDD:409410 2/4 (50%)
Ig strand F 90..95 CDD:409410 2/5 (40%)
Ig strand G 101..104 CDD:409410 1/2 (50%)
Ig2_FcgammaR_like 112..194 CDD:409411 23/97 (24%)
Ig strand B 128..132 CDD:409411 1/3 (33%)
Ig strand C 142..146 CDD:409411 2/3 (67%)
Ig strand E 159..163 CDD:409411 1/3 (33%)
Ig strand F 173..178 CDD:409411 2/9 (22%)
Ig strand G 187..190 CDD:409411 0/2 (0%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653
Ig 103..177 CDD:143165
IG_like 191..269 CDD:214653 19/77 (25%)
IGc2 198..258 CDD:197706 14/62 (23%)
I-set 273..360 CDD:254352 21/89 (24%)
Ig 290..359 CDD:143165 18/71 (25%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.