DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCER1A and CG7166

DIOPT Version :9

Sequence 1:NP_001374209.1 Gene:FCER1A / 2205 HGNCID:3609 Length:257 Species:Homo sapiens
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:193 Identity:42/193 - (21%)
Similarity:63/193 - (32%) Gaps:65/193 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    20 PDGVLAVPQKPKVSLNPPWNRIFKGENVTLTC--NGNNFFEVSSTKWFHNGSLSEET----NSSL 78
            |..:.|:|...:|:..       ||..|||.|  :||   .|.:..||.....|..|    :|:|
  Fly   134 PPTLRALPHNGQVTAR-------KGSTVTLECKASGN---PVPTIFWFKKDVFSGPTHLSDSSTL 188

Human    79 NIVNAKFEDSGEYKCQHQ-----------QVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRC 132
            .:.|.....:|.|:|...           |:....|..:.|...|:                   
  Fly   189 ILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWV------------------- 234

Human   133 HGWRNWDVYKV-IYYKDGEALKYWYEN------------------HNISITNATVEDSGTYYC 176
            |....:||..| |.:.|..:...||:|                  :::.|.|....|.|.|.|
  Fly   235 HASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNYSC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCER1ANP_001374209.1 Ig1_FcgammaR_like 30..108 CDD:409410 22/94 (23%)
Ig strand B 47..51 CDD:409410 3/3 (100%)
Ig strand C 61..65 CDD:409410 0/3 (0%)
Ig strand E 76..80 CDD:409410 2/3 (67%)
Ig strand F 90..95 CDD:409410 2/4 (50%)
Ig strand G 101..104 CDD:409410 0/2 (0%)
Ig2_FcgammaR_like 112..194 CDD:409411 16/84 (19%)
Ig strand B 128..132 CDD:409411 0/3 (0%)
Ig strand C 142..146 CDD:409411 2/4 (50%)
Ig strand E 159..163 CDD:409411 0/3 (0%)
Ig strand F 173..178 CDD:409411 2/4 (50%)
Ig strand G 187..190 CDD:409411
CG7166NP_001262181.1 IG_like 50..133 CDD:214653
Ig 56..116 CDD:143165
IG_like 144..221 CDD:214653 21/86 (24%)
IGc2 151..209 CDD:197706 18/60 (30%)
IG_like 232..313 CDD:214653 16/85 (19%)
Ig 242..311 CDD:143165 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.