DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCER1A and unc-40

DIOPT Version :9

Sequence 1:NP_001374209.1 Gene:FCER1A / 2205 HGNCID:3609 Length:257 Species:Homo sapiens
Sequence 2:NP_491664.1 Gene:unc-40 / 172233 WormBaseID:WBGene00006776 Length:1415 Species:Caenorhabditis elegans


Alignment Length:190 Identity:42/190 - (22%)
Similarity:78/190 - (41%) Gaps:28/190 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    76 SSLNIVNAKFEDSGEYKCQHQQVNES--EPVYLEVFS-DWLLLQASAEVVMEGQPLFLRCHGWRN 137
            ||:.:..|..||:|.|.|:....::|  ..|.:||.: ..:..:.:.:|.:|...:.|.|.....
 Worm   298 SSILVSRASIEDTGLYTCRASNNDDSIDRAVSVEV
RAPPRITTRPTTKVAVETADVELECGTAAA 362

Human   138 WDVYKVIYYKDGEAL---KYW-YENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNI-TVIKA 197
            ....:|.:||:|||:   :|: .|.:.:.|......|...|.|   :.:.|..||..:. .::.|
 Worm   363 RPEARVNWYKNGEAIIGSEYFVIEPNRLRILGVVRADQAIYQC---IAENDVGSEQASAQLLVDA 424

Human   198 PREKYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN 257
            |...             ..|..:|:.:::...    |.::.|..|.|.:|....|..:.|
 Worm   425 PDSS-------------SVAASSGVPMTSSAP----LGLRSTSSGSRFINVEWDPPVQRN 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCER1ANP_001374209.1 Ig1_FcgammaR_like 30..108 CDD:409410 10/33 (30%)
Ig strand B 47..51 CDD:409410
Ig strand C 61..65 CDD:409410
Ig strand E 76..80 CDD:409410 2/3 (67%)
Ig strand F 90..95 CDD:409410 2/4 (50%)
Ig strand G 101..104 CDD:409410 1/4 (25%)
Ig2_FcgammaR_like 112..194 CDD:409411 19/86 (22%)
Ig strand B 128..132 CDD:409411 1/3 (33%)
Ig strand C 142..146 CDD:409411 1/3 (33%)
Ig strand E 159..163 CDD:409411 0/3 (0%)
Ig strand F 173..178 CDD:409411 2/4 (50%)
Ig strand G 187..190 CDD:409411 2/2 (100%)
unc-40NP_491664.1 I-set 42..130 CDD:254352
Ig 43..142 CDD:299845
I-set 149..236 CDD:254352
Ig 158..237 CDD:299845
IG_like 251..332 CDD:214653 10/33 (30%)
IGc2 258..320 CDD:197706 8/21 (38%)
I-set 336..422 CDD:254352 19/88 (22%)
Ig 352..422 CDD:299845 17/72 (24%)
FN3 441..529 CDD:238020 7/31 (23%)
FN3 536..627 CDD:238020
FN3 635..727 CDD:238020
FN3 738..816 CDD:214495
FN3 852..927 CDD:214495
FN3 946..1038 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.