DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEPACAM and Hepacam

DIOPT Version :9

Sequence 1:XP_016872850.1 Gene:HEPACAM / 220296 HGNCID:26361 Length:468 Species:Homo sapiens
Sequence 2:XP_038938232.1 Gene:Hepacam / 300517 RGDID:1306811 Length:418 Species:Rattus norvegicus


Alignment Length:470 Identity:395/470 - (84%)
Similarity:404/470 - (85%) Gaps:54/470 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKRERGALSRASRALRLAPFVYLLLIQTDPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSDRP 65
            |||||.|||||||||||:|||||||||..||||||||||||||||||||||||||||||||||:|
  Rat     1 MKREREALSRASRALRLSPFVYLLLIQPVPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSDKP 65

Human    66 VVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDT 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    66 VVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDT 130

Human   131 FTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLL 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   131 FTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLL 195

Human   196 SPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSSLYIILSTGGIFLLVTLVTVC 260
            ||||||||||||||||||||||:|||||||.||||||||||||||||||||||||||||||||||
  Rat   196 SPDQKVLTITRVLMEDDDLYSCVVENPISQVRSLPVKITVYRRSSLYIILSTGGIFLLVTLVTVC 260

Human   261 ACWKPSK--RKQKKLEKQNSLEYMDQNDDRLKPEGELPATQSPIPSTIRSVGCWEKAELGDKENS 323
            |||||||  ||::|||||||||||||||||||.|                               
  Rat   261 ACWKPSKKSRKKRKLEKQNSLEYMDQNDDRLKSE------------------------------- 294

Human   324 SAGTLPPPTARRLQRRERFGQADTLPRSGEQERKNPMALYILKDKDSPETEENPAPEPRSATEPG 388
                                 ||||||||||||||||||||||||||.|.:||||.||||.||||
  Rat   295 ---------------------ADTLPRSGEQERKNPMALYILKDKDSSEPDENPATEPRSTTEPG 338

Human   389 PPGYSVSPAVPGRSPGLPIRSARRYPRSPARSPATGRTHSSPPRAPSSPGRSRSASRTLRTAGVH 453
            ||||||||.||||||||||||||||||||||||||||||:||||||||||||||:||:|||||||
  Rat   339 PPGYSVSPPVPGRSPGLPIRSARRYPRSPARSPATGRTHTSPPRAPSSPGRSRSSSRSLRTAGVH 403

Human   454 IIREQDEAGPVEISA 468
            .||||||||.|||||
  Rat   404 RIREQDEAGQVEISA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEPACAMXP_016872850.1 None
HepacamXP_038938232.1 Ig 43..141 CDD:416386 96/97 (99%)
FR1 43..59 CDD:409353 15/15 (100%)
Ig strand A 43..45 CDD:409353 1/1 (100%)
Ig strand A' 48..50 CDD:409353 1/1 (100%)
Ig strand B 53..60 CDD:409353 6/6 (100%)
CDR1 60..65 CDD:409353 4/4 (100%)
FR2 66..71 CDD:409353 4/4 (100%)
Ig strand C 66..70 CDD:409353 3/3 (100%)
CDR2 72..87 CDD:409353 14/14 (100%)
Ig strand C' 75..80 CDD:409353 4/4 (100%)
Ig strand C' 84..87 CDD:409353 2/2 (100%)
FR3 98..124 CDD:409353 25/25 (100%)
Ig strand D 98..103 CDD:409353 4/4 (100%)
Ig strand E 105..109 CDD:409353 3/3 (100%)
Ig strand F 119..124 CDD:409353 4/4 (100%)
CDR3 125..133 CDD:409353 7/7 (100%)
FR4 134..141 CDD:409353 6/6 (100%)
Ig strand G 134..140 CDD:409353 5/5 (100%)
Ig 148..236 CDD:416386 85/87 (98%)
Ig strand A 148..151 CDD:409353 2/2 (100%)
Ig strand A' 154..159 CDD:409353 4/4 (100%)
Ig strand B 164..170 CDD:409353 5/5 (100%)
Ig strand C 178..183 CDD:409353 4/4 (100%)
Ig strand C' 185..188 CDD:409353 2/2 (100%)
Ig strand D 192..196 CDD:409353 3/3 (100%)
Ig strand E 199..204 CDD:409353 4/4 (100%)
Ig strand F 214..222 CDD:409353 6/7 (86%)
Ig strand G 226..235 CDD:409353 7/8 (88%)
Herpes_UL1 <324..383 CDD:392246 53/58 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 310 1.000 Domainoid score I14950
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H17652
Inparanoid 1 1.050 725 1.000 Inparanoid score I8481
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG40373
OrthoDB 1 1.010 - - D123160at9347
OrthoFinder 1 1.000 - - FOG0010511
OrthoInspector 1 1.000 - - oto135841
orthoMCL 1 0.900 - - OOG6_115396
Panther 1 1.100 - - LDO PTHR12080
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6650
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1515.480

Return to query results.
Submit another query.