DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf1 and Traf4

DIOPT Version :9

Sequence 1:NP_001313530.1 Gene:Traf1 / 22029 MGIID:101836 Length:409 Species:Mus musculus
Sequence 2:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster


Alignment Length:434 Identity:100/434 - (23%)
Similarity:162/434 - (37%) Gaps:152/434 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 SSSAPDENEFQFGCPPAPCQDPSEPRVLCCTACLSENLRDDEDRI--CPKCR----ADN--LHPV 59
            |.:..:|:....|..|..|:.....|:|.....|.:: :|...|:  |..|:    ||.  ||..
  Fly   172 SGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKS-KDCAKRLRRCAHCQREFSADTLPLHAA 235

Mouse    60 S-PGSPLT---------------QEKVHSDVAEAEIMCPFAGVGCSFKGSPQSMQEHEATSQSSH 108
            . |.:||.               :..:..:.....:.|.|...||.|||..|.::.|..::.::|
  Fly   236 QCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAH 300

Mouse   109 LYLLLAVLKEWKSSPGSNLGSAPMALERNLSELQLQAAVEATGDLEVDCYRAPCCESQEELALQH 173
            |.|::|:        .|..|.....|:..:|:|.:                              
  Fly   301 LSLMVAL--------SSRQGQQIQMLKSAVSKLSI------------------------------ 327

Mouse   174 LVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQRVVELQQTLAQ 238
                                                                             
  Fly   328 ----------------------------------------------------------------- 327

Mouse   239 KDQVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLY 303
                              ::.||.|||||:.:.:..|:.....:.|.||.|||::|||||...::
  Fly   328 ------------------NYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMF 374

Mouse   304 LNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLD---QNNREHAIDAFRPDLSSASFQ 365
            |||:|.|:.||:|::|.::.|||||||.|||.:.:||.|.:   |:.:....::|.||.:..:||
  Fly   375 LNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQ 439

Mouse   366 RPQSETN-VASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVDTS 408
            ||.:|.: :..|.|.|.....|.|  ..::|.||:||:..||.|
  Fly   440 RPSNEPDQLGFGFPRFISHELLHS--RPFIKGDTVFLRVKVDPS 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf1NP_001313530.1 SMC_prok_B <126..257 CDD:274008 4/130 (3%)
TRAF_BIRC3_bd 180..237 CDD:374713 0/56 (0%)
MATH_TRAF1 260..406 CDD:239748 60/149 (40%)
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 7/33 (21%)
zf-TRAF 233..292 CDD:424248 12/58 (21%)
MATH_TRAF4 331..479 CDD:239750 60/149 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3301
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.