DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HYLS1 and Hyls1

DIOPT Version :10

Sequence 1:NP_659451.1 Gene:HYLS1 / 219844 HGNCID:26558 Length:299 Species:Homo sapiens
Sequence 2:NP_001137828.1 Gene:Hyls1 / 7354432 FlyBaseID:FBgn0087041 Length:242 Species:Drosophila melanogaster


Alignment Length:173 Identity:41/173 - (23%)
Similarity:64/173 - (36%) Gaps:58/173 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   117 ESESGTENDQDLWDLRQRLMNVQFQEDKESSF-DVSQKFN-----------------LPHEYQGI 163
            |.|..|:.|.||.:          :.|..:|| |:::.|.                 :|.:.|..
  Fly    89 EKECKTDKDDDLKE----------RSDGGASFADLARLFKEQLLMDASVPPMSANNAVPQKSQVN 143

Human   164 SQDQLICSLQRE------GMGSPAYEQDLIVASRPKSFILPKLDQLSRN-----RGKT---DRVA 214
            .:.:.....:||      ...|.|.|..|.:..|.:|...|:.....|:     |.|:   |.||
  Fly   144 GRRRSRSKTRREKAPSISSSESEANEDRLRMQRRRRSKSHPRSASNRRSGSVHQRRKSMHCDPVA 208

Human   215 RYFEYKRDWDSIR--LPGEDHRKELRWGVREQMLCRAEPQSKP 255
            .:..|:::|...|  :|||:    .|.|||          |||
  Fly   209 LFQYYQKEWAHFRSQIPGEN----TRIGVR----------SKP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HYLS1NP_659451.1 HYLS1_C 198..284 CDD:464636 20/68 (29%)
Hyls1NP_001137828.1 None

Return to query results.
Submit another query.