DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYSND1 and CG9588

DIOPT Version :10

Sequence 1:NP_775826.2 Gene:TYSND1 / 219743 HGNCID:28531 Length:566 Species:Homo sapiens
Sequence 2:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster


Alignment Length:65 Identity:21/65 - (32%)
Similarity:28/65 - (43%) Gaps:13/65 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   243 LSNVAGPLLLTDARCLPGTEGGGVFTARPAGALVAL-VVAP--LCWKAGEWVGFTLLCAAAPLFR 304
            |.|.|..|.|...|. ||  |..:....||.|:|.: :|:|  ...:||       |||...:.|
  Fly    99 LVNRASALDLDSDRS-PG--GANITDLAPARAIVVVNLVSPDSPAERAG-------LCAGDAILR 153

Human   305  304
              Fly   154  153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYSND1NP_775826.2 Trypsin_2 357..496 CDD:433149
CG9588NP_650301.1 Nas2_N 11..90 CDD:465689
RseP <130..>208 CDD:440513 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.