DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARMC3 and p120ctn

DIOPT Version :9

Sequence 1:NP_775104.2 Gene:ARMC3 / 219681 HGNCID:30964 Length:872 Species:Homo sapiens
Sequence 2:NP_001036444.1 Gene:p120ctn / 3355143 FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster


Alignment Length:722 Identity:141/722 - (19%)
Similarity:247/722 - (34%) Gaps:202/722 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     9 VEPPPKDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTTLLELGAVEPLT 73
            :|....|:...:.......:.|:..|::|...|.|.|...:.......:.||.....||.:.||.
  Fly   209 IEGSENDICSTMRWRDPNLSEVISFLSNPSSAIKANAAAYLQHLCYMDDPNKQRTRSLGGIPPLV 273

Human    74 KLLTHEDKIVRRNA-----TMIFGILASNNDVKKLLRELDVMNSVIAQLAPEEEVVIHEFASLCL 133
            :||:::...:.:||     .:.:|  ..|::.|:.::....:.:::..|...:|..:.|..:..|
  Fly   274 RLLSYDSPEIHKNACGALRNLSYG--RQNDENKRGIKNAGGIAALVHLLCRSQETEVKELVTGVL 336

Human   134 ANMSAEYTSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDFQCRAKLQELNAIPPILD 198
            .|||:....|..|.:    |.|:.::.|.   :|.:|       ..|..|..:            
  Fly   337 WNMSSCEDLKRSIID----EALVAVVCSV---IKPHS-------GWDAVCCGE------------ 375

Human   199 LLKSEYPVIQLLALKTLGVIAN----DKESRTMLRDNQGLDHLIKIL--------ETKELNDLHI 251
                  .....:.....||:.|    .:.:|..||:   .:||::.|        |...:.:..:
  Fly   376 ------TCFSTVFRNASGVLRNVSSAGEHARGCLRN---CEHLVECLLYVVRTSIEKNNIGNKTV 431

Human   252 EALAVIANC---LEDMDTMVQIQQTGGLKKLLSFAENSTIPDIQKNAAKAITKAAYDPENRKLFH 313
            |      ||   |.::....|........|.........||...|.            ||...|.
  Fly   432 E------NCVCILRNLSYRCQEVDDPNYDKHPFITPERVIPSSSKG------------ENLGCFG 478

Human   314 EQEVEKCLVALLGSENDGTKIAASQAISAMCENSGSKDFFN--NQGIPQL---------IQLLKS 367
            ..:.:|        |.:.:.......|||  :.|.|...:|  |:|..||         :.||:|
  Fly   479 TNKKKK--------EANNSDALNEYNISA--DYSKSSVTYNKLNKGYEQLWQPEVVQYYLSLLQS 533

Human   368 -DNEEVREAAALALANLTTC--NPA---NANAAAEADGIDPLINLLSSKRDGAIANAATVLTNMA 426
             .|.|..||||.|:.||:.|  .|:   .|....| .|:..|:.||..:.|..:...||.|.|:|
  Fly   534 CSNPETLEAAAGAIQNLSACYWQPSIDIRATVRKE-KGLPILVELLRMEVDRVVCAVATALRNLA 597

Human   427 MQEPLRLNIQNHDI-----MHAIISPLRSANTV----VQSKAALAVTATACDV-----EARTELR 477
            :.:      :|.::     |..::..|.|.|..    .......||.||..:|     |....|.
  Fly   598 IDQ------RNKELIGKYAMRDLVQKLPSGNVQHDQNTSDDTITAVLATINEVIKKNPEFSRSLL 656

Human   478 NSGGLEPLVELLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKF-SE 541
            :|||::.|:.:.:.|    .|:.|                |.|                 || |:
  Fly   657 DSGGIDRLMNITKRK----EKYTS----------------CVL-----------------KFASQ 684

Human   542 AAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGRINPGTKLLPLKELCLQEPSDLRAVLLINS 606
            ..|....:|.|...|.:.|: ...:.::..|                                  
  Fly   685 VLYTMWQHNELRDVYKKNGW-KEQDFVSKHF---------------------------------- 714

Human   607 KSYVSPPSSMEDKSDVGYGRSISSSSSLRRSSKEKNKKNSYHFSAGFGSPIEDKSEPASGRNTVL 671
            .::.:||||..:.::. ..|.::|....|...:...:..|..:||.     :......|..:.:|
  Fly   715 TAHNTPPSSPNNVNNT-LNRPMASQGRTRYEDRTIQRGTSTLYSAN-----DSSGAVMSNESAML 773

Human   672 SKSATKE 678
            |:...|:
  Fly   774 SEMVRKQ 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARMC3NP_775104.2 ARM 1 15..54 7/38 (18%)
armadillo repeat 21..52 CDD:293788 6/30 (20%)
HEAT_2 32..108 CDD:290374 18/80 (23%)
ARM 2 57..96 11/43 (26%)
armadillo repeat 60..96 CDD:293788 10/40 (25%)
ARM 63..179 CDD:237987 25/120 (21%)
ARM 3 98..138 7/39 (18%)
HEAT repeat 106..137 CDD:293787 5/30 (17%)
ARM 4 140..179 7/38 (18%)
armadillo repeat 143..177 CDD:293788 7/33 (21%)
ARM 145..259 CDD:237987 19/125 (15%)
HEAT_2 152..258 CDD:290374 18/117 (15%)
ARM 5 181..220 3/38 (8%)
armadillo repeat 184..220 CDD:293788 2/35 (6%)
ARM 6 222..262 10/50 (20%)
armadillo repeat 225..259 CDD:293788 8/41 (20%)
ARM 7 264..304 5/39 (13%)
ARM 8 306..345 8/38 (21%)
ARM 321..426 CDD:237987 36/121 (30%)
ARM 9 346..385 19/50 (38%)
armadillo repeat 358..383 CDD:293788 12/34 (35%)
ARM 10 388..427 12/41 (29%)
armadillo repeat 391..436 CDD:293788 12/44 (27%)
ARM 11 429..468 9/47 (19%)
ARM 435..529 CDD:237987 21/107 (20%)
armadillo repeat 435..465 CDD:293788 7/38 (18%)
ARM 12 470..509 10/43 (23%)
armadillo repeat 473..503 CDD:293788 8/29 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 610..693 14/69 (20%)
EDR1 <720..858 CDD:291079
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 25/115 (22%)
armadillo repeat 227..252 CDD:293788 6/24 (25%)
armadillo repeat 260..296 CDD:293788 9/35 (26%)
armadillo repeat 304..339 CDD:293788 5/34 (15%)
ARM 307..442 CDD:237987 30/175 (17%)
armadillo repeat 347..392 CDD:293788 10/76 (13%)
armadillo repeat 515..556 CDD:293788 15/40 (38%)
ARM 516..643 CDD:237987 37/133 (28%)
armadillo repeat 562..596 CDD:293788 10/34 (29%)
armadillo repeat 601..641 CDD:293788 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.