DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnr and NimB4

DIOPT Version :9

Sequence 1:NP_071707.2 Gene:Tnr / 21960 MGIID:99516 Length:1358 Species:Mus musculus
Sequence 2:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster


Alignment Length:318 Identity:76/318 - (23%)
Similarity:116/318 - (36%) Gaps:85/318 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    83 LEASAEQ---DMSAEDDTLAEYIGQTSDHESQVTFTHKINLPKKACPCASSSQVLQELLSRIEML 144
            |...|||   ::..|.:.|...:..::.........:.::||::.   ....:..||:.:.....
  Fly    42 LRLRAEQRQRELLREHEALQRRLSSSTTTRKPYIIPNGLSLPRRG---EHPDKCRQEVPAVFFQY 103

Mouse   145 EREVSLLRDQCNTN--------CCQESAATGQLDY-----VPHCS---GHGNFSFESCGCICNEG 193
            ::||.::.:. :||        ||:   ...:.:|     ||.|.   ....|......|:|...
  Fly   104 DKEVKIVGNS-STNPYMNVIEVCCK---GWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTD 164

Mouse   194 W---FGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSEL---RCPTDCSSRGLCVD-GECV 251
            :   :..|| .|.|||||......::|.|.||..|..|...:.   :|...|....:|:: |:|.
  Fly   165 FVLNYRNNC-VPTCPLGCPHGRCYLNGTCQCDKGYELDGSRKFCQPQCNATCGHNEVCLEPGKCS 228

Mouse   252 CEEPYTG---------------EDC---------------------RELRCPGDC---SGKGQCA 277
            |.|.||.               .||                     ..:.|.|||   ...|.||
  Fly   229 CAEGYTRGLRESAALGCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCA 293

Mouse   278 N-GTCLCQEGYAGEDCSQRRCLNACSGRGHCQEGLCI------CEEGY--QGPDCSAV 326
            | .||:||.||. .|.:...||..|.  .:|..|:||      |.:||  ....|.||
  Fly   294 NKTTCVCQNGYR-YDKNTTTCLPDCG--DNCDNGVCISPGNCRCFKGYVRNRERCEAV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TnrNP_071707.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..58
exchanger_TraA <190..>328 CDD:411343 54/192 (28%)
EGF_Tenascin 203..231 CDD:376143 11/27 (41%)
fn3 328..398 CDD:394996
fn3 416..496 CDD:394996
fn3 507..586 CDD:394996
FN3 595..679 CDD:238020
fn3 687..766 CDD:394996
fn3 776..855 CDD:394996
fn3 865..944 CDD:394996
fn3 954..1026 CDD:394996
FN3 1042..1127 CDD:238020
FBG 1134..1343 CDD:214548
NimB4NP_788046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.