DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglyrp1 and PGRP-SC2

DIOPT Version :9

Sequence 1:NP_033428.1 Gene:Pglyrp1 / 21946 MGIID:1345092 Length:182 Species:Mus musculus
Sequence 2:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster


Alignment Length:181 Identity:77/181 - (42%)
Similarity:110/181 - (60%) Gaps:8/181 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQAR 65
            :|| || .|:||:.     |:.:|||....:...:.|.:.:.|.||.||||::|::..:|..|.:
  Fly    11 VLF-CA-QAVLGVT-----IISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQ 68

Mouse    66 NVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKR 130
            |:|.||.:.|||.|:.||||||.||:||||||||:.|.| ...||..||||:|:||:........
  Fly    69 NIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAH-ATNWNSKSIGISFLGNYNTNTLTSA 132

Mouse   131 ALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYR 181
            .:.||..||...||||.:.|.|.:.|||.|.||..||..::..|::|.:::
  Fly   133 QITAAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglyrp1NP_033428.1 PGRP 20..160 CDD:128941 63/139 (45%)
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 63/146 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842398
Domainoid 1 1.000 132 1.000 Domainoid score I5082
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4341
Isobase 1 0.950 - 0 Normalized mean entropy S6354
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm44042
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4719
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.650

Return to query results.
Submit another query.