DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4C6 and or30by3

DIOPT Version :9

Sequence 1:NP_001004704.1 Gene:OR4C6 / 219432 HGNCID:14743 Length:309 Species:Homo sapiens
Sequence 2:NP_001034713.1 Gene:or30by3 / 554780 ZFINID:ZDB-GENE-010308-3 Length:328 Species:Danio rerio


Alignment Length:302 Identity:78/302 - (25%)
Similarity:145/302 - (48%) Gaps:19/302 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     8 TEFILLGLTE-NLELWKIFSAVFLVMYVATVLENLLIVVTIITSQSLRSPMYFFLTFLSLLDVMF 71
            |||.|||... :.:.:.....:||.:|:..:..|:.|:..|...:||:.|.|.....|::.|:.|
Zfish    19 TEFYLLGFPGLHPDYYGALGTLFLFVYLTLLGGNIFIIAFIAYEKSLQKPTYVIFCNLAVCDLTF 83

Human    72 SSVVAPKVIVDTLSKSTTISLKGCLTQLFVEHFFGGVGIILLTVMAYDRYVAICKPLHYTIIMSP 136
            .:||.|:.|........|||...|..|:|.......|...::.:|..||:|||..||.|.::::.
Zfish    84 GTVVLPQAIAMYFININTISFNLCFVQMFFLFCLSNVSSFIILLMTIDRFVAIRNPLRYCVLITN 148

Human   137 RVCCLMVGGAWVGGFMHAMIQLLF--MYQIPFCGPNIIDHFICDLFQLLTLACTDTHILGLLVTL 199
            :...:..|..|.  |:..::..:.  .|..|:|..|::...:|:...::.|:|.|     :...|
Zfish   149 KTVFIACGVIWT--FITPLMAFIVYQSYDEPYCASNVVTQILCERNVVIKLSCRD-----IRQKL 206

Human   200 NSGMMCVAIFLI-----LIASYTVILCSLKSYS-SKGRHKALSTCSSHLTVVVLFFVP--CIFLY 256
            .....|..|.::     ::.|:..|..|:.:.| |:.|:|..|||...|.::.|.|:.  .:::|
Zfish   207 YLTFACTVIIVVGPPIFILCSFIGIFTSVFNISNSQARYKTFSTCFPQLFLICLHFLSKLVVYVY 271

Human   257 MRPVVTHPIDK-AMAVSDSIITPMLNPLIYTLRNAEVKSAMK 297
            ...|...|..: |:.:...::.|::||:||..:..|:|.|::
Zfish   272 DVTVTMSPSFRIAITLCSCLLPPVVNPMIYCFKTKEIKDAIR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4C6NP_001004704.1 7tmA_OR4A-like 23..289 CDD:320605 69/276 (25%)
TM helix 1 24..50 CDD:320605 6/25 (24%)
TM helix 2 57..83 CDD:320605 8/25 (32%)
TM helix 3 95..125 CDD:320605 9/29 (31%)
TM helix 4 138..159 CDD:320605 3/20 (15%)
TM helix 5 193..223 CDD:320605 5/34 (15%)
TM helix 6 229..259 CDD:320605 9/31 (29%)
TM helix 7 264..289 CDD:320605 7/25 (28%)
or30by3NP_001034713.1 7tm_4 41..312 CDD:304433 71/277 (26%)
7tm_1 51..301 CDD:278431 64/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.