DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnnc2 and Eip63F-1

DIOPT Version :9

Sequence 1:NP_033420.1 Gene:Tnnc2 / 21925 MGIID:98780 Length:160 Species:Mus musculus
Sequence 2:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster


Alignment Length:160 Identity:47/160 - (29%)
Similarity:82/160 - (51%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 SEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFL 77
            :|..|.:.:.|||:.|.:..|.::..||..:::.||...:.|.:..:|.|....|:|.|:..|||
  Fly    33 TEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFL 97

Mouse    78 VMMVR--------QMKEDAKGKS--------EEELAECFRIFDRNADGYIDAEELAEIFRASGEH 126
            ..:.|        ...||:|...        .|:|...||:|||:.:|:|..:||.......||.
  Fly    98 QWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEP 162

Mouse   127 VTEEEIESLMKDGDKNNDGRIDFDEFLKMM 156
            :.|:::|.|:...|.:.||||:::||.:::
  Fly   163 LNEQQLEQLLVIADLDQDGRINYEEFTRLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tnnc2NP_033420.1 PTZ00184 12..156 CDD:185504 47/158 (30%)
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 47/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.