DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnc and CG31832

DIOPT Version :9

Sequence 1:NP_001356140.1 Gene:Tnc / 21923 MGIID:101922 Length:2110 Species:Mus musculus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:221 Identity:77/221 - (34%)
Similarity:115/221 - (52%) Gaps:25/221 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse  1890 PRDCSQAMLNGDTTSGLYTIYINGDK----TQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWK 1950
            |..|.....|     |::.:.:..::    ||     |..|:  ..|||..||.:|..:|.::|.
  Fly    22 PHTCPSGSPN-----GIHQLMLPEEEPFQVTQ-----CKTTA--RDWIVIQRRLDGSVNFNQSWF 74

Mouse  1951 AYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESA--YAVYDRFSVGDAKSRYKL-KV 2012
            :|..||||...||::||..|..:|.:..:||.:.|: ||..|  ||.:|.|.|......||| :|
  Fly    75 SYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLK-HGPGATVYAHFDDFQVDSETELYKLERV 138

Mouse  2013 EGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRY---GDNNHSQ 2074
            ..||||||||:.||..:.|||:|:|.|.:..|||..:.|.:|:.:|...:|.|.|   |:.....
  Fly   139 GKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLN 203

Mouse  2075 GVNWFHWKGHEYSIQFAEMKLRPSNF 2100
            |::|..||..  |:.|.::.:||..|
  Fly   204 GIHWGRWKFQ--SLTFVQIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TncNP_001356140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..91
EGF_2 222..247 CDD:285248
EGF_2 345..372 CDD:285248
EGF_2 377..403 CDD:285248
EGF_2 408..434 CDD:285248
EGF_2 468..496 CDD:285248
EGF_2 504..527 CDD:285248
EGF_2 533..558 CDD:285248
EGF_2 592..620 CDD:285248
FN3 624..710 CDD:238020
fn3 713..793 CDD:333790
FN3 804..891 CDD:238020
fn3 894..976 CDD:333790
fn3 986..1064 CDD:333790
fn3 1075..1147 CDD:333790
fn3 1169..1246 CDD:333790
fn3 1257..1336 CDD:333790
fn3 1348..1417 CDD:333790
fn3 1442..1519 CDD:333790
fn3 1530..1610 CDD:333790
fn3 1620..1699 CDD:333790
fn3 1711..1785 CDD:333790
fn3 1797..1869 CDD:333790
Fibrinogen_C 1889..2098 CDD:278572 75/217 (35%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 73/211 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.