DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBLN1 and frac

DIOPT Version :9

Sequence 1:NP_006477.3 Gene:FBLN1 / 2192 HGNCID:3600 Length:703 Species:Homo sapiens
Sequence 2:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster


Alignment Length:661 Identity:194/661 - (29%)
Similarity:275/661 - (41%) Gaps:183/661 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    37 CADGHRMATHQKDCSLPYATESKECRMVQEQCCHSQLEELH-------CATGISLANEQ------ 88
            |.:|:.:...|:.|:|...|:.:..::.:.:|.| :.::|.       |..|..|:.:|      
  Fly   445 CVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAH-ECQDLPEGSYRCVCPKGYELSEDQHSCLVQ 508

Human    89 -DRCATPHG-------------DNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQV 139
             ..|:|..|             ||.|..          |:.....:::..||:..    .:|.:.
  Fly   509 ESPCSTEKGVEKCSPGTCLASEDNTSFS----------CICPTGYRSEAFSCQDI----DECAED 559

Human   140 FQACCVKSQETGDLDVGGLQ-ETDKIIEVEEEQEDPY---LNDRCR-GGGPCKQQCRDTGDEVVC 199
            ...|....|.|    .||.| :..:.:.:.||    |   ..:.|. ....|:|.|. |....||
  Fly   560 THLCSHTCQNT----PGGYQCQCPEGLNLVEE----YTCLAENLCEVNNNGCEQICL-TARGGVC 615

Human   200 SCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNS----C 260
            :|..|::|.:||.|||||:||:..:..|:  :.|.|..||:.|    .|..||||.:.:.    |
  Fly   616 ACREGFRLSADGKSCEDVDECLVNNGGCQ--QVCRNLPGSYGC----ICAAGYELLKLDGIRGYC 674

Human   261 KDIDECESGIHNCLPDFICQNTLGSFRCRPKLQC----------------KSGFIQDALGN---- 305
            .|||||....|.|....:|:|..||:.|    .|                .|.||.|:..:    
  Fly   675 FDIDECSQRTHGCSDQMLCENLNGSYTC----LCPPGYALGLDNHIVTSLNSSFITDSTSSETPS 735

Human   306 ---CIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPC 367
               |:||:||...:..|  .|.|.|..|.:.|.     |..||.|:|:...|.|:|||......|
  Fly   736 AHTCLDIDECSLANGNC--SHFCQNEPGGFQCA-----CPLGYALSEDMRTCQDIDECLDSNGQC 793

Human   368 GKGHRCVNSPGSFRCECKTGYYF--DGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGF 430
            .:  .|:|.||.|.|.|:||:..  ||..  |.|::||.:..|. |...|.|.||::.|:|..|:
  Fly   794 SQ--LCLNQPGGFACACETGFELTPDGFG--CADIDECSQDYGN-CSDICINLLGTHACACERGY 853

Human   431 RLSVDGRSCEDINECS---SSPCSQECANVYGSYQCYCRRGYQLSD------------------- 473
            .|:.|..||.|::||:   |..||.||.|..|:::|.|..||.|:|                   
  Fly   854 ELAKDKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRS 918

Human   474 VDGVT---------------CEDIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNC 523
            .||..               |.|||||....||  ||:||.|..|||:|||| .||.|..:.:.|
  Fly   919 ADGCAPIECNPGYTLGSDDKCVDIDECQKQNGG--CSHRCSNTEGSFKCSCP-PGYELDSDQKTC 980

Human   524 QDIDECVTGIHNCSINETCFNIQGGFRC-----------------------------------LA 553
            ||||||.....:| |..||.|..|||||                                   |:
  Fly   981 QDIDECDQDKTSC-ITGTCINEIGGFRCEFPKFPVLPEIPTASSLPESPKIELKTPKYPDFTELS 1044

Human   554 FECPENYRRSA 564
            .|.|||.::.|
  Fly  1045 NEIPENPKKPA 1055

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBLN1NP_006477.3 vWFA <395..438 CDD:320736 15/42 (36%)
cEGF 421..444 CDD:315355 8/22 (36%)
cEGF 460..484 CDD:315355 11/57 (19%)
vWFA <479..522 CDD:320736 23/42 (55%)
cEGF 504..528 CDD:315355 13/23 (57%)
EGF_CA 525..>561 CDD:311536 20/70 (29%)
ANATO 30..79 CDD:237984 9/48 (19%)
ANATO 97..152 CDD:237984 10/54 (19%)
EGF_CA 216..259 CDD:311536 15/42 (36%)
EGF_CA 262..>298 CDD:328759 14/51 (27%)
EGF_CA 308..355 CDD:214542 15/46 (33%)
Self-association and FN1-binding, calcium is necessary for homotypic binding, but not for heterotypic binding 356..440 32/85 (38%)
EGF_CA 356..389 CDD:238011 14/32 (44%)
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433
FXa_inhibition 425..458 CDD:291342 3/12 (25%)
FXa_inhibition 476..505 CDD:291342 7/29 (24%)
vWFA <550..586 CDD:294047 8/43 (19%)
FXa_inhibition 596..630 CDD:291342 12/34 (35%)
FXa_inhibition 636..>664 CDD:291342 10/33 (30%)
EGF_CA 676..715 CDD:284955 13/42 (31%)
FXa_inhibition 745..780 CDD:291342 12/41 (29%)
FXa_inhibition 786..821 CDD:291342 13/38 (34%)
FXa_inhibition 827..862 CDD:291342 12/35 (34%)
FXa_inhibition 874..904 CDD:291342 12/29 (41%)
FXa_inhibition 945..980 CDD:291342 18/37 (49%)
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2524
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.