DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspan7 and Tsp39D

DIOPT Version :9

Sequence 1:NP_062608.2 Gene:Tspan7 / 21912 MGIID:1298407 Length:249 Species:Mus musculus
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:235 Identity:61/235 - (25%)
Similarity:113/235 - (48%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 ITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLFG 76
            :||:|.|....:.:|.:||:::..||...:|....|.:.::::...||.:|:..|..:.|....|
  Fly     6 LTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVICFLG 70

Mouse    77 CFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFR---HEIKDTFLRTYTDAMQNYNGNDERS 138
            |....:.|..|:..:|:...::||.|:..|::|:|..   |:|.::   .:...||:|....:..
  Fly    71 CCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMES---QFNSTMQHYKERADYR 132

Mouse   139 RAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETDCNPLDLHNLTVAA----TKVNQK 199
            .|...:|..|.|||:....:|.:  .:.:..:|.:||         .:.||:.|.    |...|.
  Fly   133 DAWTLLQTELDCCGINGPNDWET--VYRNSTLPAACC---------SVINLSEAKECTNTHATQH 186

Mouse   200 GCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSR 239
            ||...:...:::...|:|.|..|:|..|::.:|.||||.|
  Fly   187 GCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tspan7NP_062608.2 Tetraspannin 15..237 CDD:395265 56/228 (25%)
TM4SF2_6_like_LEL 110..213 CDD:239414 23/109 (21%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 60/233 (26%)
tetraspanin_LEL 104..200 CDD:239401 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43294
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.