DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tll1 and CG15253

DIOPT Version :9

Sequence 1:NP_033416.2 Gene:Tll1 / 21892 MGIID:106923 Length:1013 Species:Mus musculus
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:222 Identity:78/222 - (35%)
Similarity:113/222 - (50%) Gaps:16/222 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse   141 EKNRVPRAAT-----SRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFTE-RSDE 199
            |.:.||..::     :.|.| ||..:|.|.|........|.....|::..|..:|:||.| .:|:
  Fly    37 EGDMVPSGSSRNIWRNETYR-WPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQ 100

Mouse   200 ESYIVFTYRPCGCCSYVGRRGNGPQAIS-----IGKNCDKFGIVVHELGHVIGFWHEHTRPDRDN 259
            :.|:..|....||.||:|.. |..|.::     ||..|.:...:|||..|.:||:|:.:..|||:
  Fly   101 KYYVNVTSEEGGCFSYIGYL-NRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDD 164

Mouse   260 HVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRP 324
            :|.|:.|||..|.|:||.|.....||..||:||:.|:|||....||:. ...|||..  :.|...
  Fly   165 YVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKN-GERTILAL--EEGKED 226

Mouse   325 AIGQRTRLSKGDIAQARKLYRCPACGE 351
            .||||..||:.||.:...:|:||...|
  Fly   227 VIGQRLELSETDIRKLNAIYKCPTVKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tll1NP_033416.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..150 3/8 (38%)
ZnMc_BMP1_TLD 148..347 CDD:239808 72/209 (34%)
Astacin 155..348 CDD:279708 72/198 (36%)
CUB 349..458 CDD:278839 1/3 (33%)
CUB 462..571 CDD:278839
FXa_inhibition 582..614 CDD:291342
CUB 618..727 CDD:278839
FXa_inhibition 734..769 CDD:291342
CUB 774..883 CDD:278839
CUB 887..1000 CDD:278839
CG15253NP_609758.1 Astacin 55..250 CDD:279708 72/199 (36%)
ZnMc_astacin_like 59..246 CDD:239807 67/190 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.