DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nkx2-1 and bap

DIOPT Version :9

Sequence 1:XP_011242403.1 Gene:Nkx2-1 / 21869 MGIID:108067 Length:423 Species:Mus musculus
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:323 Identity:89/323 - (27%)
Similarity:119/323 - (36%) Gaps:112/323 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse    54 MSPKHTTPFSVSDILS----------------------PLEESYKKVGMEGGGLGAPLAAYR--- 93
            :|...|||||::|||:                      |..:..:.:..........|..|:   
  Fly    16 LSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQ 80

Mouse    94 ----QGQAAPPAAAMQQHAV-----GHHGAVTAAYHMTAAGVPQLSHSAVGG---------YCNG 140
                |..|..|:..:|.:|.     .||...|...:.:||...|...:..|.         .|..
  Fly    81 PKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTS 145

Mouse   141 NLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMA 205
            |..:....||...:                   |:.|......||::                  
  Fly   146 NDSDCDSPPPLSSS-------------------PSESPLSHDGSGLS------------------ 173

Mouse   206 PLPSAPRRKR-RVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 269
                  |:|| |..||.|||:||||||.||:|||.|||..:|..:.||.|||||||||.|||.||
  Fly   174 ------RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR 232

Mouse   270 QAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVK-DGKPCQAGAPAPGA 331
                    :|:|                |.:.|...:.:||.|.|||: ||....|...||||
  Fly   233 --------KQIQ----------------QHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nkx2-1XP_011242403.1 Homeobox 215..269 CDD:395001 36/54 (67%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.