DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Timm17a and Tim17b2

DIOPT Version :9

Sequence 1:NP_035720.1 Gene:Timm17a / 21854 MGIID:1343131 Length:171 Species:Mus musculus
Sequence 2:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster


Alignment Length:167 Identity:100/167 - (59%)
Similarity:125/167 - (74%) Gaps:8/167 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGINHRLRGSLTAIKTRAPQLGGS 65
            ||||:|||||.||||||||||.||.:|||:||..|||||:|.|:..|:.||:.||||::|.:|||
  Fly     1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGS 65

Mouse    66 FAVWGGLFSTIDCSMVQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAG 130
            ||.||.:||.:|||:|..|.||||||||.|||:||.|||:|||..||.|||.:||:||::|||.|
  Fly    66 FAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLG 130

Mouse   131 ILLTRFASAQFPNGPQFTEDHSQLPSSQLPSSPFGDY 167
            |..||||:.||.|    .|.|. :|.:   :..:||:
  Fly   131 IFFTRFAAEQFRN----REPHI-MPDA---NEGYGDF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Timm17aNP_035720.1 3a0801so1tim17 1..171 CDD:130053 100/167 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..171 5/24 (21%)
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 97/154 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842462
Domainoid 1 1.000 170 1.000 Domainoid score I3755
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3486
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54844
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm8714
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.