DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie1 and drpr

DIOPT Version :9

Sequence 1:NP_035717.2 Gene:Tie1 / 21846 MGIID:99906 Length:1134 Species:Mus musculus
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:218 Identity:61/218 - (27%)
Similarity:78/218 - (35%) Gaps:87/218 - (39%)


- Green bases have known domain annotations that are detailed below.


Mouse   213 CGAGRWGPGCVKDCPGCLHGGVCHDHDGECVCPPGFTGTRC------------------------ 253
            |..|.:||||.:.|. |..|..||...|:|.||||:.|.||                        
  Fly   261 CPVGSYGPGCQESCE-CYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAM 324

Mouse   254 --------------------EQACREGRFGQSCQEQC-----------PGTAGC----------- 276
                                |:.|...::|..|...|           |.|..|           
  Fly   325 CDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQC 389

Mouse   277 -RGLTF------------------CLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNG 322
             |..||                  |.|....|.|..||||..|:|:|.||.||.||.|:|.||||
  Fly   390 TRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNG 454

Mouse   323 GTCDRFSG-CVCPSGWHGVHCEK 344
            ..|:..:| |:|.:||..:.|::
  Fly   455 AKCEPETGQCLCTAGWKNIKCDR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tie1NP_035717.2 ig 127..208 CDD:278476
IG_like 131..210 CDD:214653
EGF_Lam 225..263 CDD:238012 16/81 (20%)
EGF_CA 312..343 CDD:238011 14/31 (45%)
ig 353..439 CDD:278476
IG 367..441 CDD:214652
fn3 447..518 CDD:278470
fn3 546..628 CDD:278470
FN3 640..732 CDD:238020
PTKc_Tie1 832..1128 CDD:270671
TyrKc 835..1103 CDD:197581
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 14/45 (31%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.