DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eif4e1b and eIF4EHP

DIOPT Version :9

Sequence 1:NP_001273108.1 Gene:Eif4e1b / 218268 MGIID:2685119 Length:250 Species:Mus musculus
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:134 Identity:47/134 - (35%)
Similarity:77/134 - (57%) Gaps:10/134 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    63 PPEVLSKLHPLQYRWVLWFFKNDRSRAWQD---NLQLVTKFNTVEDFWAVYSHIKLASKLSSGCD 124
            |.||....:.||:.:.|||.:.:..||..|   :|.:|.:..:|:.:|::|||:...:.|....:
  Fly    38 PLEVGPGENRLQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRE 102

Mouse   125 YALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVN 189
            ..|||:||:|||||..|.:||:||:    :||..::||.|....:.::|..| ....|:||.|  
  Fly   103 LLLFKQGIIPMWEDPANSKGGQWLI----RLRKNKVDRAWENVCMAMLGEQF-LVGDEICGVV-- 160

Mouse   190 IRTK 193
            ::||
  Fly   161 LQTK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eif4e1bNP_001273108.1 IF4E 75..231 CDD:279921 42/122 (34%)
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 42/122 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.